DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8192 and thw

Sequence 1:NP_611047.2 Gene:CG8192 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001097699.2 Gene:thw FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster

Alignment Length:481 Identity:92/482 (19%)
Similarity:156/482 (32%) Gaps:188/482 (39%)


  Fly    83 EYSEEDQEEAPRPVYANRNAKQQSNYLKIQGQLKKPLSEESEEEE--------EEVEEPDRLSTL 139
            ::.||..|       |:.|..:..::      |||..|:|..:.|        ..::.|  :...
  Fly    55 QFEEERYE-------AHTNCNEHKHH------LKKRASDEDVDYEVYQGVVGRPGIDFP--IYPR 104

  Fly   140 LSKSSFSCTDRNSGYYADESLSCEVFHYCQESQKHSWICPEGFTFHQIHLICMPPSHDNICKQSS 204
            :.|:||||....:||:||....|:|||.|:|.:|.|::||.|..|.|..|.|......| |..||
  Fly   105 IPKTSFSCRSYGNGYFADMETDCQVFHICEEGRKISFLCPNGTIFQQSELTCDWWFKVN-CLGSS 168

  Fly   205 KYHIVNDYLYKPINLQE-HQSKPNVTLR------------------------YSERYFPENYYEH 244
            .|:..:..:   :|.|. |:.:|:|.::                        .:.|..|      
  Fly   169 GYYAESAEI---LNKQRVHRVRPSVPVQGFNIVGGGLNIKPKVTPVAGQGRSAAPRANP------ 224

  Fly   245 ERYDDEEEQLPAAPR----------------PRIQQQHHQQQHQQPQQQ--------HRQVLAYQ 285
            :|..|..|.:||:..                |.|....:.|:.|...:.        .|:.....
  Fly   225 DRRIDSTEDVPASVESVDFDDVSGEKQRKVLPSIDNNSNDQESQITAESSSFVSGSGKRRTNKES 289

  Fly   286 QPQQQPQVRV------------------------------QYQQPQQHQHHQQQAQP-QAQVVTQ 319
            .|.:...:.|                              :|...::|...:::..| |::...:
  Fly   290 NPNRNDDITVLKPARLRTPVATQERGVSTERARNGQRGQHRYSGSEEHSKERERPTPGQSKEKPE 354

  Fly   320 I--RHQPQPQPTTLAYRKPQPVTTVQPQLQLHQLHQPQLQLHQQRPQTLAPTV------------ 370
            .  .|..:..|.|.|:......:||:           :|:..:..| ...|||            
  Fly   355 FFEAHSTRSVPQTTAHYSTGSHSTVR-----------RLEPSKSTP-FYTPTVPSLVKSKSTEGK 407

  Fly   371 -----------TPAPYRFFTA----------APQLQ----------------------HLQQQQQ 392
                       ||.|:||.:|          ||:::                      |......
  Fly   408 LNYIKGGHVATTPNPHRFGSASSGIFIESSVAPKVKPTASASIELDSTFKPVIIGMRHHYDVASS 472

  Fly   393 QVFRTPEEINISLQQRRPQVFIATTP 418
            ..||.|.:   |.:.|.   ::.|||
  Fly   473 GEFRPPSK---STESRD---YLPTTP 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 21/53 (40%)
thwNP_001097699.2 CBM_14 112..164 CDD:279884 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.