DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8192 and CG13676

Sequence 1:NP_611047.2 Gene:CG8192 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_648179.3 Gene:CG13676 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster

Alignment Length:405 Identity:84/406 (21%)
Similarity:154/406 (38%) Gaps:113/406 (28%)


  Fly    86 EEDQEEAPRPVYANRNAKQQSNYLKIQGQLKKPLSEESEEEEEEVEEPDR--------------L 136
            ||.:||.|.|...:.:..:..|     |.|.|........:.:.:.:|:.              |
  Fly    58 EEVEEEQPVPTADSSDGSKSDN-----GTLLKNSKLTGIPQIDYIWDPNLPRELRGYNLSTYPFL 117

  Fly   137 STL--LSKSSFSCTDRNSGYYADESLSCEVFHYCQESQKHSWICPEGFTFHQIHLICMPPSHDNI 199
            ||:  :.:..|.|...:.|:||.....|:::|:|....:|.::|.....|.|...||...| |..
  Fly   118 STVPPMDEIHFKCEGLHDGFYASIEYKCQIYHHCVYGIRHDFLCANFTAFDQRTFICHFAS-DVD 181

  Fly   200 CKQSSKYHIVNDYLYK------------------PINLQEHQSKPNVTLR--YSERYFPENYYE- 243
            |:.|.||...||.||.                  |...:....:|...||  |:.|...:.||| 
  Fly   182 CEGSQKYWNRNDELYMATTTTSTSTTTTPAPPTLPPAPRRRPQRPQRPLRRPYNRRPIDDYYYED 246

  Fly   244 HERYDDE--EEQLPAAPRPRIQQQHHQQQHQQPQQQHRQVLAYQQPQQQPQV-------RVQYQQ 299
            .::|:|:  ||:....|:||            |:|        ::||.:|:.       |.:.::
  Fly   247 QDQYEDDYYEERPVRRPKPR------------PRQ--------RKPQVEPEYDDEYDDKRTEAKK 291

  Fly   300 PQQHQHHQQQAQPQA---QVVTQIRHQPQPQPTT------LAYRKPQPVTTVQPQLQLHQLHQPQ 355
            |.:...::.:.:.:|   ....:...:|:.:||.      ::.|||..|             :.:
  Fly   292 PIRRNRNRYRDEEEALDEDYDERPSKRPRGKPTAGTAGRKISPRKPGRV-------------EER 343

  Fly   356 LQLHQQRP----QTLAPTVTPA-----------PYRFFTAAPQLQHLQQQ-QQQVFRTPEEINIS 404
            ...::.||    ::.....||:           ||   .:|.|::..::| .|:|..||:.:...
  Fly   344 RSFNEDRPLGRRRSEKERTTPSSALDDLDEYEKPY---NSADQVEAAEEQTPQKVKTTPKPLTEF 405

  Fly   405 LQQRRPQVFIATTPR 419
            :..:.....:...||
  Fly   406 ITPKAAAASVYARPR 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 15/53 (28%)
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.