DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8192 and CG12009

Sequence 1:NP_611047.2 Gene:CG8192 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_647799.1 Gene:CG12009 FlyBaseID:FBgn0035430 Length:905 Species:Drosophila melanogaster

Alignment Length:361 Identity:87/362 (24%)
Similarity:140/362 (39%) Gaps:105/362 (29%)


  Fly   111 IQGQLKKPLSEESEEEEEEVEE--------PDRLSTLLS--KSSFSCTDRNSGYYADESLSCEVF 165
            :..:::.|...|:|:||...|.        |...:::.|  ..:|||.::..|||||....|::|
  Fly    36 VPAEVEMPEQTETEDEEAPAEAASMGTLTLPSNATSIRSDITDNFSCVNKTYGYYADVENDCQIF 100

  Fly   166 HYC---------QESQKHSWICPEGFTFHQIHLICMPPSHDNI-CKQSSKYHIVNDYLYKPINLQ 220
            |.|         :.:.:.|:||||...|.|....||......| |:.||:|:.:|.....|   .
  Fly   101 HVCLPVTYADGRENTFRWSFICPEETIFSQESFTCMRREDMTIECEDSSRYYELNGNFGGP---A 162

  Fly   221 EHQSKPNVTLRYSERYFPENYYEHERYDDEEEQLPAAPRPRIQQQHHQQQHQQPQQQHRQVLAYQ 285
            |.:|||.          |....|.|:.:.|.|..|....|.|.        .:|:.|        
  Fly   163 EEESKPT----------PVESEEPEKEESEPEPEPVESEPEIP--------AEPEVQ-------- 201

  Fly   286 QPQQQPQVRVQYQQPQQHQHHQQQAQPQAQVVTQIRHQPQ----PQPTTLAYRKPQPVTTVQPQL 346
              ..:|...|:.|:|:.   ::::.|||.:|...:...|:    |:|:.....:|:|   ::|| 
  Fly   202 --TAKPMKPVKAQKPKP---NRRKPQPQRKVPAVVTAAPEVEAIPEPSAPVEMEPKP---LKPQ- 257

  Fly   347 QLHQLHQPQLQLHQQRPQTLAPTVTPAPYR------------FFTAAP----------------- 382
              ....:|    ||:|||...|.:...|.|            .|...|                 
  Fly   258 --RFTSRP----HQERPQVKRPAIAAPPMRNELFNGIRKRPAIFNKPPTTVKPVEEVVENEPAVT 316

  Fly   383 ----QLQHLQQ--QQQQVFRTPEEINISLQQRRPQV 412
                ||...|.  :.|.:|..||.|.:.:|:  |:|
  Fly   317 EAVVQLSEPQPTLKLQTLFAEPEVIPVEVQE--PEV 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 20/63 (32%)
CG12009NP_647799.1 CBM_14 82..145 CDD:279884 20/63 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.