DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8192 and CG5756

Sequence 1:NP_611047.2 Gene:CG8192 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_611292.2 Gene:CG5756 FlyBaseID:FBgn0034301 Length:1220 Species:Drosophila melanogaster

Alignment Length:498 Identity:118/499 (24%)
Similarity:173/499 (35%) Gaps:163/499 (33%)


  Fly    25 ASTGSPSA---TATTAKPKGFEARS---LDVNSSGGEEELDDFETQA-------QTHLAYRQQPQ 76
            ||.||.:|   ::||:.|:.:.|.:   ..||.:.|:....:|:|||       .|..:..|:|.
  Fly   717 ASVGSSNAATTSSTTSAPRSYIAATSTRATVNVNRGKNRYSNFKTQAPVQRTRGTTTTSTTQRPT 781

  Fly    77 QQRQL---------------YEYSEEDQEEAPRP-----VYANRNAKQQSNYLKIQGQLKKPLSE 121
            .....               |.|::..|...|.|     |||...|...:.:             
  Fly   782 SSLSSLNQHISALASNYNGGYSYNQATQISKPIPQSPSHVYATHTASDIAGH------------- 833

  Fly   122 ESEEEEEEVEEPDRLSTLLSKSSFSCTDRNSGYYADESL-------SCEVFHYCQESQKHSWICP 179
                    ..:....|:|...|:|...|:.:....|||:       ..:..:..|::|:..    
  Fly   834 --------ASQSQTTSSLTPASAFLSFDKLTRAIVDESVLQNFKSAQSQGSNQAQQNQRQQ---- 886

  Fly   180 EGFTFHQIHLICMPPSHDNICKQSSKYHIVNDYLYKPINL-------------QEHQSK------ 225
                 .|.|         .:.||  ::|.|:....||...             |..||.      
  Fly   887 -----QQQH---------QVAKQ--QHHSVSSSYVKPAAAPAISSLTVPQRPQQTSQSSVPPGIV 935

  Fly   226 ----------PN--------------VTLRYSERYFPENYYEHERYDDEEEQLPAA--------- 257
                      ||              ||......|...|.:.:.::.    |.|||         
  Fly   936 IARAEGQRIAPNSASSIISSLATQAPVTSNQGNSYVSLNDFLNNKFG----QSPAASSNVHSAAT 996

  Fly   258 ----PRPRIQQ------QHHQQQHQQP--QQQHRQVLAYQQPQQQPQ--VRVQYQQPQQHQHHQQ 308
                .:|..||      |..|||.:||  ||||:.|...:||.||..  :..|||||||...:||
  Fly   997 LQQEQQPHYQQQATLSLQQQQQQQRQPVLQQQHQLVQQQRQPVQQQLSFISQQYQQPQQQSIYQQ 1061

  Fly   309 QAQPQAQVVTQIRHQPQPQPTTLAYRKPQPVTTVQPQLQLHQLHQPQLQLHQQRPQTLAPTVTPA 373
            ..|||.|  .|.:|..|.|..|..:...||..|  |.:.: ..||.|.||.|..|  |||.|:.:
  Fly  1062 YKQPQQQ--QQQQHFQQQQQRTTIHTNQQPYLT--PNIFV-PYHQQQQQLPQFPP--LAPPVSIS 1119

  Fly   374 PYRFFTAAPQL--QHLQQQQQQVFRTPEEI--NISLQQRRPQV 412
            ... ....|.:  :|:.....|:...|..:  .:.|.|:|..|
  Fly  1120 TGN-IAQGPVIAGRHVDHLNVQLPTLPNGLIPGLQLAQKRSDV 1161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 8/60 (13%)
CG5756NP_611292.2 CBM_14 70..126 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.