DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8192 and Y56A3A.6

Sequence 1:NP_611047.2 Gene:CG8192 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_499539.1 Gene:Y56A3A.6 WormBaseID:WBGene00013227 Length:798 Species:Caenorhabditis elegans

Alignment Length:491 Identity:98/492 (20%)
Similarity:155/492 (32%) Gaps:164/492 (33%)


  Fly    35 TTAKPKGFEARSLDVNSSGGEE-----------------ELDDFETQAQTHLAYRQQPQQQRQ-- 80
            |:..||...|.|...:|||...                 :..:|.:|.       .||.|.|.  
 Worm   245 TSDLPKTGSASSQSSSSSGNNNHNNNNNNVKKQLPLKIPQYGNFYSQP-------SQPAQNRSPP 302

  Fly    81 ----------LYEYSEEDQEEAPRPVYANRN-----AKQQSNYLKIQGQLKKPLS---------- 120
                      :|:.:..::.....|| .|.|     ..:..|.:......|.|.|          
 Worm   303 VAPQAAPGGTVYKRTSREKLSPKSPV-PNGNIISPKTDENRNIVVTSASPKNPPSQNTVAVDRLR 366

  Fly   121 ---EESEEEEEEVEE---PDRLSTLLSKSSFSCTDRNSGYYADESLSCEVFHYCQESQKHSWICP 179
               ||..:.|:||::   |..|.:..|....|...|...|.|.:|...|               |
 Worm   367 REVEEQRQREKEVKQYRNPRALESQASPRKSSPGPRMVEYKAMKSPGLE---------------P 416

  Fly   180 EGFTFHQIHLICMPPSHDNICKQSSKYHIVNDYLYKP----------INLQEHQSKPNVTLRYSE 234
            :| .:.:|    .||...|...:.|.|......:..|          :.||.:..||.....:..
 Worm   417 DG-VYEEI----APPIPKNPPPKLSDYRKEQQTVVAPRMPSVPTNGYVRLQMNGKKPAPVTPHPV 476

  Fly   235 RYFPENYYEHERYDDEEEQLPAAPRPRIQQQHHQQQHQQPQQQHRQVLAYQQPQQQPQV---RVQ 296
            :..|..|...| |....:.|...|.|.      :.....|.::.::|  |::||..||:   .|:
 Worm   477 KLSPTPYTGPE-YSSSPKLLRKTPEPA------KIYSSVPVKEEKKV--YEKPQAHPQIAPPMVR 532

  Fly   297 YQQPQQHQHHQQQAQPQAQVVTQIRHQPQPQPTTL---------------AYRKPQPVTTVQPQL 346
            .....|:.::.|:::|     .:::.:|...|..:               ..||.| ||..|..:
 Worm   533 AASVDQNGNNYQRSKP-----VEVKPRPVSSPLMIRAASVDQNPMTASPSVIRKSQ-VTATQSPV 591

  Fly   347 QLHQLHQPQLQLHQQRPQTLAPTVTPAPYRFFTA--------APQLQHLQQQQQQVFRTPEEINI 403
            ...:: .|.....|:||.......:|..||..:|        ||               |...::
 Worm   592 SYRKI-PPTSPTPQRRPLNNTEVPSPVTYRKISAPVQKVTSPAP---------------PAARSV 640

  Fly   404 SLQQ-----RRPQVFI--------------ATTPRY 420
            |..|     ||.||.|              ||:|.|
 Worm   641 STDQPPPANRRSQVGILSATSSKATVTVTSATSPPY 676

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 11/53 (21%)
Y56A3A.6NP_499539.1 PHA03247 <448..704 CDD:223021 53/261 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.