DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc-73 and KAR3

DIOPT Version :9

Sequence 1:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster
Sequence 2:NP_015467.1 Gene:KAR3 / 856263 SGDID:S000006345 Length:729 Species:Saccharomyces cerevisiae


Alignment Length:360 Identity:126/360 - (35%)
Similarity:193/360 - (53%) Gaps:30/360 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKVAVRVRPFNRREIELDTKCIVEMEKQQTILQNPPPLEKIER-KQPKTFAFDHCFYSLNPEDEN 69
            |:|..|:||..:.....||..|...|...........:.||:. .|...|.||..|   :.:|.|
Yeast   387 IRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIF---DQQDTN 448

  Fly    70 FASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTMMGTQESKGIIPRLCDQLFSAIANK 134
            .    .||..||: ::.::..|||.||||||||||||::||:...:  ||||.....:|:.|...
Yeast   449 V----DVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD--GIIPSTISHIFNWINKL 506

  Fly   135 STPELMYKVEVSYMEIYNEKVHDLL-DPKPNKQSLKV-------REHNVMGPYVDGLSQLAVTSY 191
            .|....|||...::|||||.:.||| ....||:...:       .:.......:..::...:.|.
Yeast   507 KTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESE 571

  Fly   192 QDIDNLMTEGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEKVSRMSLVDLAGSER 256
            :.::.::.:.||.|:.|:|..|..|||||::|.:.|:.  ::..||  ......::|||||||||
Yeast   572 EMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSG--SNAKTG--AHSYGTLNLVDLAGSER 632

  Fly   257 AVKTGAVGDRLKEGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKDNLGGNS 321
            ...:..|||||:|..||||||:.||.||..|     |:.....:.:|:|:|.||:||:.:|.|:|
Yeast   633 INVSQVVGDRLRETQNINKSLSCLGDVIHAL-----GQPDSTKRHIPFRNSKLTYLLQYSLTGDS 692

  Fly   322 RTVMVATISPSADNYEETLSTLRYADR--AKRIVN 354
            :|:|...||||:.:..|||::||:|.:  :.|:|:
Yeast   693 KTLMFVNISPSSSHINETLNSLRFASKVNSTRLVS 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816 126/360 (35%)
KISc 6..359 CDD:214526 126/360 (35%)
Kinesin_assoc 356..468 CDD:292801
FHA 446..546 CDD:238017
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625
KAR3NP_015467.1 Smc 98..>387 CDD:224117 126/360 (35%)
KISc_C_terminal 384..725 CDD:276817 124/356 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.