DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc-73 and KIF2B

DIOPT Version :9

Sequence 1:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster
Sequence 2:NP_115948.4 Gene:KIF2B / 84643 HGNCID:29443 Length:673 Species:Homo sapiens


Alignment Length:440 Identity:153/440 - (34%)
Similarity:220/440 - (50%) Gaps:67/440 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIKVAVRVRPFNRREIELDTKCIVEMEKQQTIL--QNPPPLEKIERKQPKTFAFDHCFYSLNPED 67
            :|.|.||.||.|:||..|....|:.:.....::  ::...::.....|.:||.|||.|       
Human   213 RICVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTFCFDHAF------- 270

  Fly    68 ENFASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTM----MGTQE--SKGIIPRLCDQ 126
            ::.||.|.|:....:.::::.|:...|..||||||||||:|||    .||.:  ||||...:...
Human   271 DDKASNELVYQFTAQPLVESIFRKGMATCFAYGQTGSGKTYTMGGDFSGTAQDCSKGIYALVAQD 335

  Fly   127 LFSAIANKSTPELMYKVEVSYMEIYNEKVHDLLDPKPNKQSLKVREHNVMGPYVDGLSQLAVTSY 191
            :|..:.|.:..:|..||..::.|||..||:|||:   .|:.|:|.|.......|.||.:..|...
Human   336 VFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLN---WKKKLQVLEDGNQQIQVVGLQEKEVCCV 397

  Fly   192 QDIDNLMTEGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEKV-SRMSLVDLAGSE 255
            :::.||:..||..||...|.:||.||||||||.::|.          ||..: .:.|||||||:|
Human   398 EEVLNLVEIGNSCRTSRQTPVNAHSSRSHAVFQIILK----------SGRIMHGKFSLVDLAGNE 452

  Fly   256 R-AVKTGAVGDRLKEGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKDN-LG 318
            | |..|.|...|..||:.|||||..|...|..|..        |....|:|.|.||.:|:|: :|
Human   453 RGADTTKASRKRQLEGAEINKSLLALKECILALGQ--------NKPHTPFRASKLTLVLRDSFIG 509

  Fly   319 GNSRTVMVATISPSADNYEETLSTLRYADRAKRIVNHAVVNED--PNARIIRELRHEVETLRSML 381
            .||.|.|:|||||...:.|.||:|||||:|.|::      |.|  |..|....:.||..   .||
Human   510 QNSSTCMIATISPGMTSCENTLNTLRYANRVKKL------NVDVRPYHRGHYPIGHEAP---RML 565

  Fly   382 KHATGSPVGDVQDKLAESENLMKQISQTWEEKLVKTERIQNERQQALEKM 431
            |    |.:|:.:..|...|             .:|...:|:|.|:.:|::
Human   566 K----SHIGNSEMSLQRDE-------------FIKIPYVQSEEQKEIEEV 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816 135/364 (37%)
KISc 6..359 CDD:214526 135/363 (37%)
Kinesin_assoc 356..468 CDD:292801 18/78 (23%)
FHA 446..546 CDD:238017
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625
KIF2BNP_115948.4 KISc_KIF2_like 213..541 CDD:276818 134/355 (38%)
Kinesin 219..541 CDD:278646 131/349 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.