DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc-73 and ventx3.1

DIOPT Version :9

Sequence 1:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster
Sequence 2:NP_001107738.1 Gene:ventx3.1 / 100135744 XenbaseID:XB-GENE-919686 Length:273 Species:Xenopus tropicalis


Alignment Length:142 Identity:35/142 - (24%)
Similarity:61/142 - (42%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1781 EWIVVGESVLIRPYNTSGVIRFVGTTEFQPGAWIGVELD----TPTGKNDGSVKGVQYFQCKPKH 1841
            ||:  .||.|.:|..|.        ||...| :.|::.:    |......|:::.......|...
 Frog     9 EWL--SESSLGKPVYTK--------TEHTFG-YSGLQFNKDCRTSLSSRPGNLRSSANSTEKEND 62

  Fly  1842 GMF-VRSDKLMLDKRGKAMRAYKAAEKSNSISKEM-----STSMTGSMTRSKSRGDSLNLS-ARK 1899
            |:. |.:.::.:..:.|...:.:..|.|..:.:||     :|:||.|..:|.|..|..|:| ||.
 Frog    63 GLSNVLNGRISVAAQIKTRPSLQEPEISRKVLREMQPTDQATNMTDSSKKSPSLSDEENVSRART 127

  Fly  1900 XLYPKCSHQLQR 1911
             ..|:...:|:|
 Frog   128 KFTPEQLKELER 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816
KISc 6..359 CDD:214526
Kinesin_assoc 356..468 CDD:292801
FHA 446..546 CDD:238017
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625 14/68 (21%)
ventx3.1NP_001107738.1 Homeobox 126..179 CDD:365835 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.