DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir100a

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_651898.2 Gene:Ir100a / 43753 FlyBaseID:FBgn0039879 Length:603 Species:Drosophila melanogaster

Alignment Length:698 Identity:120/699 (17%)
Similarity:232/699 (33%) Gaps:221/699 (32%)


  Fly     5 IIILLCLGYTKARILDATNTNH----TDLEERL---LSLLLRLQQEQFFNTLLIYGEDCAFSSLS 62
            :|:|..:|.|..:   |.||:|    |.:.::|   |.|.||..::.        |.|.....:.
  Fly     7 LIMLALVGGTLGQ---ANNTDHKQVLTSIVKQLEGGLELHLRTSEDG--------GNDLVQFLMQ 60

  Fly    63 RRLQVPTILVSSGSTSFEWNYSSLALILTCEFKAEREENYQTLKKLQMNRRLILLNGNIKPDSVC 127
            .:   .:|::|:                       ::|...:..|: |.....:.:|..:...:.
  Fly    61 EK---SSIIISA-----------------------KQEEVPSRAKI-MRHHFFIFDGVHQMQEIR 98

  Fly   128 DFYSKKDQYNIAMVNNNFHQVGII---YACRLFQERNYEKVY---LSEGNPIYVDQFRNMQGALL 186
            ......|.:.|..:.||..:..::   :|..::.:..:.::|   ||:.:.:..:.|......:.
  Fly    99 TSLFNTDGFYILALENNTIEDDVLLMEFAADVWLQHGHSRIYYVQLSKKSVLLFNPFLQRLVVVQ 163

  Fly   187 KSITFNLIPGSMAYRDPKTGQEKHIGYV-----ANLLNNFVEKVNATLDMQVKLHK-AGKKTSFY 245
            .|.|::.|     |:|.: |....| |:     ::::.:...||.:......||.| ..::.:|.
  Fly   164 DSKTYSRI-----YKDLE-GYHLRI-YIFDSVYSSVIGDGENKVLSVTGADAKLAKTVARQLNFT 221

  Fly   246 NITKWASEDLV-------------------DIGMSYAAYF---EMTNFDTISYPYLMTSTCFMVP 288
            ....|..::..                   ::.:.:|.:|   .:|.....|....|...|..|.
  Fly   222 ADFVWPDDEFFGGRLANGEYSGGVGRAHRGEVDIIFAGFFIKDYLTTHIQFSAAVYMDELCLYVK 286

  Fly   289 LPDMMPNSEIYMGIVDPPVLVVLIAIFCIFSVMLNYIKQRSWRSLSLVNVLLNDICLRGFLAQP- 352
            ....:|.|.:       |:..|.:.::..| :::..:....|..|..||::|      |....| 
  Fly   287 KAQRIPQSIL-------PLFAVHMDVWLCF-LLVGLLGALVWLILRAVNLIL------GIEGVPD 337

  Fly   353 -------------------------------FPFPRQSNR----KLKLISMLVCFFSVITTTMYT 382
                                           || |..|.|    .|.|:|  |.|.:::.:::.|
  Fly   338 GSRATRISYFGAARRIFVDTWVIWVRVNVGRFP-PFHSERIFVASLCLVS--VIFGALLESSLAT 399

  Fly   383 SYLQSFMW------------GPPIDPKMCSFA-DLENSRYKLAIRRYDIEMLRPFNVSMDHVVVF 434
            .|::...:            |.||..|..:|. ||.........||.|.:|:         :|..
  Fly   400 VYIRPLYYRDVNTLRELDESGQPIYIKHPAFKDDLFYGHNSEVYRRLDAKMM---------LVAE 455

  Fly   435 DESSQLEYL--RDSF---DDNYMYPMSALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFFSFPIR 494
            .|...:|.:  |..|   ..:....:|.:.:...|:..|:...|..|:           .::.:.
  Fly   456 GEERLIEMVSKRGGFAGVTRSASLQLSDIRYVMTKKVHKIPECPKNYH-----------IAYVLP 509

  Fly   495 RHLPYRDLFEEHMLQQNEFGLSTYWIDRSFS----------------DMVRLKLATMNDFSPPRL 543
            |..||.:.....:|:....|:...|...:..                |:.|.|:.|::|..    
  Fly   510 RPSPYLEEVNRIVLRLVAGGIVGLWTGEAKERAKWSIQRFPEYLAELDVGRWKVLTLSDVQ---- 570

  Fly   544 EDYIEVSDLSWVFGMYFTGLGISC-----CCFGLELLGLPSWTRRLRL 586
                          :.|..|.|.|     .|....|||     |:.||
  Fly   571 --------------LAFYALTIGCLLSAIVCMAEILLG-----RQRRL 599

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir52dNP_611042.2 None
Ir100aNP_651898.2 Periplasmic_Binding_Protein_Type_2 210..>255 CDD:304360 4/45 (9%)
Lig_chan <439..580 CDD:278489 28/179 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.