DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir94h

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster

Alignment Length:594 Identity:136/595 (23%)
Similarity:250/595 (42%) Gaps:106/595 (18%)


  Fly    28 DLEERLLSLLLRLQQEQFFNTLLIY----GEDCAFSSLSRRLQVPTILVSSGSTSFEW------- 81
            ||...:|..|:..:      |.|.|    |:.|::.:|.|     |||  |......|       
  Fly    15 DLYGLVLKFLVSSE------TTLFYFNPTGQKCSWETLPR-----TIL--SNHPQIIWFREETYP 66

  Fly    82 ----NYSSLALILTC----------EFKAEREENYQTLKKLQMNRRLILLNGNIKPDS------- 125
                .:||...::.|          :..||....|::::        :|:....|..|       
  Fly    67 GLYKRHSSNLFVMACLSSTSYDGQLQLLAESLTRYRSVR--------VLIEVQDKEGSFLASQIL 123

  Fly   126 -VCDFYSKKDQYNIAMVNNNFHQVGIIYACRLFQERNYEKVYLSEGN---PIYVDQFRNMQGALL 186
             :|..:|   ..|:.:..:.:.:...:::...|......|..|| |:   .|:::|.:::||..:
  Fly   124 LLCQQHS---MLNVVLYFSRWTRTLNVFSYLAFPYFKLLKQRLS-GSLRPKIFINQLKDLQGYKI 184

  Fly   187 KSITFNLIPGSMAYRDPKTGQEKHIGYVANLLNNFVEKVNATLDMQVKLH----KAGKKTSFYNI 247
            :.......|.|.:||| :.|:.:..|::..::.||.:.:..  |.|| |:    ||....:.|.|
  Fly   185 RVQPDLSPPNSFSYRD-RHGECQVGGFLWRIVENFSKSLKG--DTQV-LYPTWAKAKVSAAEYMI 245

  Fly   248 --TKWASEDLVDIGMSYAAYFEMTNFDTISYPYLMTSTCFMVPLPDMMPNSEIYMGIVDPPVLVV 310
              |:..|.| :.:..:...:.....:...|||....|.|.|:|:...:....::..::.|...::
  Fly   246 QFTRNGSSD-IGVTTTMITFKHEERYRDYSYPMYDISWCTMLPVEKPLSVEILFSHVLSPGSALL 309

  Fly   311 LIAIFCIFSVMLNYIKQRSWRSLSLVNVLLNDICLRGFLAQPFPFPRQSNRKLKLISMLVCFFSV 375
            ||..|.:|.:::.          .|:..|  .|..||                :||.|....|::
  Fly   310 LILAFILFFLIVP----------QLIKCL--GITFRG----------------RLIGMASRIFAL 346

  Fly   376 ITTTMYTSYLQSFMWGPPIDPKMCSFADLENSRYKLAIRRYDIEML----RPFNVSMDHVVVFDE 436
            :.....::.|.|.:..||:..::.||.||..|..|:...|.::..|    |....|..|:.  :.
  Fly   347 VMLCSSSAQLLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELYFLDGGFRAKYASAFHLT--EN 409

  Fly   437 SSQLEYLRDSFDDNYMYPMSALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFFSFPIRRHLPYRD 501
            .::|...|:.|:.::.|.::::.|:..:.||:.||.|:|.||..||....:.:...|.....||:
  Fly   410 PNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRYSTDLCFSSETPWGLLIAPESFYRE 474

  Fly   502 LFEEHMLQQNEFGLSTYWIDRSFSDMVRLKLATMNDFSPPRLEDYIEVSDLSWVFGMYFTGLGIS 566
            ..:...|:.|:.||.|.|:.:||.:|||....|:.|:|...|...:.:.||...:.::..|||.|
  Fly   475 PLQHFTLKINQAGLITQWMTQSFHEMVRAGRMTIKDYSRTNLMKPLRIQDLRKCWVIFAVGLGTS 539

  Fly   567 CCCFGLELL 575
            ...|.:|||
  Fly   540 TVVFTIELL 548



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.