DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir94g

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster

Alignment Length:591 Identity:133/592 (22%)
Similarity:247/592 (42%) Gaps:72/592 (12%)


  Fly    21 ATNTNHTDLEERLLSLLLRLQQEQFFNTLLIYG---EDCAFSSL--SRRLQVPTILVSSGSTSFE 80
            |.|:.|:    :|:||:.|.|:   ..::..|.   |.|.....  |....:|.::..:..|...
  Fly     4 AVNSVHS----KLVSLISRGQE---LTSIFFYAPAKEKCHLEDTISSATWGLPLVIWRTDRTVIL 61

  Fly    81 WNY-SSLALILTC----EFKAEREENYQTLKKLQMNRRLILL---NGNIKPDSVCDFYSKKDQYN 137
            ..: ....|:|.|    .::|......::||.|:..|.||.|   ........|..|...:|..|
  Fly    62 NGFIGEGLLVLACLPGFHWRALLGSLARSLKYLRQARILIELMQDRDEFLVSEVLQFCLSQDMIN 126

  Fly   138 IAMVNNNF---HQVGIIYACRLFQERNYEKVYLSEGNPIYVDQFRNMQGALLKSITFNLIPGSMA 199
            :..:.::|   ..:....|...|:..|......::.:.:|.::..|::|.:::::.....|.::.
  Fly   127 VNAIFDDFPETENLSSFEAYPSFEVVNQTFTPDTQVSDLYPNKMLNLRGGVIRTMPDYSEPNTIL 191

  Fly   200 YRDPKTGQEKHIGYVANLLNNFVEKVNATLDMQVKLHKAGKKTSFYNITKWASEDLVDIGMSY-- 262
            |:| |.|.::.:||:.:||..:..|.||.|.: |..:...:..:|..:...|...::|:|.|.  
  Fly   192 YQD-KEGNKEILGYLWDLLEAYAHKHNAQLQV-VNKYADDRPLNFIELLDAAQSGIIDVGASIQP 254

  Fly   263 AAYFEMTNFDTISYPYLMTSTCFMVPLPDMMPNSEIYMGIVDPPVLVVLIAIFCIFSVMLNYIKQ 327
            .:...::....:|||....|.|.|:|:...:..||:...::..|.|.:|:.::..:.|:     :
  Fly   255 MSMGSLSRMHEMSYPVNQASWCTMLPVERQLHVSELLTRVIPYPTLALLLLLWIFYEVL-----R 314

  Fly   328 RSWRSLSLVNVLLNDICLRGFLAQPFPFPRQSNRKLKLISMLVCFFSVITTTMYTSYLQSFMWGP 392
            ..||..|                           :|:.|..||  .:.:.::.|...|.:....|
  Fly   315 GRWRRHS---------------------------RLQSIGWLV--LATLVSSNYVGKLLNLFTDP 350

  Fly   393 PIDPKMCSFADLENSRYKLAIRRYDIEMLRPFNVSMDHVVVFD---ESSQLEYLRDSFDDNYMYP 454
            |..|.:.|.|.|..|..::...|.:...:. |.....:...|.   .:|.|..||::|:.:|.|.
  Fly   351 PSLPPVNSLAALMESPVRIISIRSEYSAIE-FTQRTKYSAAFHLALHASILIGLRNAFNTSYGYT 414

  Fly   455 MSALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFFSFPIRRHLPYRDLFEEHMLQQNEFGLSTYW 519
            :::..|..::||||..:.|:|.||:.||...:..|...|..:.|:|.....:.|...:.||..:|
  Fly   415 ITSEKWKIYEEQQKRSSKPVFRYSKDLCFYEMIPFGLVIPENSPHRAPLHSYTLLLRQAGLHDFW 479

  Fly   520 IDRSFSDMVRLKLATMNDFSPPRLEDYIEVSDLSWVFGMYFTGLGISCCCFGLELLGLPSWTRRL 584
            ::|.||.||:.................:.::||..||.:|.:.|.||...|..||  ..||    
  Fly   480 VNRGFSYMVKAGKINFTAVGERYEAKTLTITDLRNVFIIYVSVLLISLILFTCEL--FVSW---- 538

  Fly   585 RLTNWL 590
             :..||
  Fly   539 -VNYWL 543



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.