DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir76a

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster

Alignment Length:558 Identity:111/559 (20%)
Similarity:203/559 (36%) Gaps:146/559 (26%)


  Fly    88 LILTCEFKAEREENYQTLKKLQMNRRLILLNGNIKPDSVCDFY--------------SKKDQYNI 138
            |::|.::.     |..|. :::.||.:...|.|..|:.| :||              ..:...:.
  Fly   159 LVITSQYL-----NSSTF-EIKTNRFVGPRNFNKNPEPV-EFYILQRFDAKGTKATWETQSAMSS 216

  Fly   139 AMVNNNFHQVGI-IYACRLFQERNYEKVYLSEGNPIYVDQFRNMQGALLKSITFNLIPGSMAYRD 202
            .|.|....:|.| |:..:.|...:|||      .|:|.|:|.|     ...:|.:          
  Fly   217 KMRNLKGREVVIGIFDYKPFMLLDYEK------PPLYYDRFMN-----TTDVTID---------- 260

  Fly   203 PKTGQEKHIGYVANLLNNFVEKVNATLDM---------QVKLHKAGKKTSFYNITKWASEDLVDI 258
                     |....|:..|.|..|.|:.:         .:.|:.:|     |.:.....:...|.
  Fly   261 ---------GTDIQLMLIFCELYNCTIQVDTSEPYDWGDIYLNASG-----YGLVGMILDRRNDY 311

  Fly   259 GMS-----YAA--YFEMTNFDTISYPYLMTS--TCFMVPLPDMMPNSEIYMGIVDPPVLVVL--I 312
            |:.     |.|  |.:||:|       |..|  || :||    .||..|...::..|...||  .
  Fly   312 GVGGMYLWYEAYEYMDMTHF-------LGRSGVTC-LVP----APNRLISWTLLLRPFQFVLWMC 364

  Fly   313 AIFCIF--SVMLNYIKQRSWRSLSLVNVLLNDI---C---LRGFLAQPFPFPRQSNRKLKLISML 369
            .:.|:.  |:.|...::....|::..|..::.:   |   |:.|:.|...:. .|:..|:.:.:.
  Fly   365 VMLCLLLESLALGITRRWEHSSVAAGNSWISSLRFGCISTLKLFVNQSTNYV-TSSYALRTVLVA 428

  Fly   370 VCFFSVITTTMYTSYLQSFMWGPPIDPKMCSFADLENSRYKLAIRRYDIEMLRPFNVSMDHVVVF 434
            .....:|.||:|:..|.:.:..|.::       :..:||.:|    :|.:::.. ..|...:...
  Fly   429 SYMIDIILTTVYSGGLAAILTLPTLE-------EAADSRQRL----FDHKLIWT-GTSQAWITTI 481

  Fly   435 DESSQLEYLRDSFDDNYMYPMSALSWSAFKEQQKLFAFPLFY-------YSEKLCLKPIS----- 487
            ||.|....|....:...:|..:.:|..:..||.......|.:       ..|...||.:.     
  Fly   482 DERSADPVLLGLMEHYRVYDANLISAFSHTEQMGFVVERLQFGHLGNTELIENDALKRLKLMVDD 546

  Fly   488 -FFSFPIR---RHLPYRDLFEEHMLQQNEFGLSTYW--------IDRSFSDMVRLKLATMNDFSP 540
             :|:|.:.   |..|:.:.:.:.:|..:..|...:|        ::....:.:.....|..|..|
  Fly   547 IYFAFTVAFVPRLWPHLNAYNDFILAWHSSGFDKFWEWKIAAEYMNAHRQNRIVASEKTNLDIGP 611

  Fly   541 PRL--EDYIEVSDLSWVFGMYFTGLGISCCCFGLELLG 576
            .:|  :::|.:. |.|.|||         .|..|..||
  Fly   612 VKLGIDNFIGLI-LLWCFGM---------ICSLLTFLG 639



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.