DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir67a

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_648329.3 Gene:Ir67a / 39110 FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster

Alignment Length:606 Identity:119/607 (20%)
Similarity:248/607 (41%) Gaps:105/607 (17%)


  Fly    33 LLSLLLRLQQEQFFNTLLIYGEDCAFSSLSRRLQVPTILV--------SSGSTSFEW-------- 81
            |:.:||...:..:.|.:|        :|:.:.....|:|:        :||...|.|        
  Fly     5 LVPVLLLFNETSWINPIL--------TSIYKDRHHETVLLLQHSQHGNASGLERFPWPVFSFNEQ 61

  Fly    82 -------NYSSLALILTCEF-KAERE-ENYQTLKK--LQMNRRLILLNGNIKPDSVCDFYSKKDQ 135
                   .|:|..|:|..:. .::.: :.:|.|.:  |.|.:..:||....:.....|..:..:.
  Fly    62 MDFYVRGKYNSEMLVLIWQTGNSDWDLDLWQALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEH 126

  Fly   136 ---YNIAMVNNNFHQVGIIYACRLFQERNYEKVYLSEGNPIYVDQFRNMQGALLKSITFNLIPGS 197
               .::|::.    |...||..:.:..:::.:|...| :||:: :.||..|..:.::.....|.|
  Fly   127 LLFLHVAVIG----QGNRIYRLQPYAPQSWLQVDPIE-SPIFI-KIRNYFGRYIVTLPDQFPPRS 185

  Fly   198 MAYRDPKTGQEKHIGYVANLLNNFVEKVNATLDMQVKLHKAGKKTSFYNITKWASEDLVDIGMSY 262
            :.||:|||.:.:..|||...|..|:...|.|...|..:.: |::.:...:........:::.:|.
  Fly   186 IVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTFRWQRPIVQ-GERMNLILLRNMTLNGTINLAISL 249

  Fly   263 AAYFEMTNFDTISYPYLMTSTCFMVPLPDMMPNSEIYMGIVDPPVLVVLIAIFCIFSVMLN---- 323
            ..:...:.....|..|.|.....|||....:..:::|:.:|....|:|||..:.||:::..    
  Fly   250 CGFETPSELGVFSDVYDMEEWYIMVPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDTCFGP 314

  Fly   324 -YIKQR-SWRSLSLVNVLLNDICLRGFLAQPFPFPRQSNRKLKLISMLVCFFSVITTTMYTSYLQ 386
             .:|:| .|.     |::||:..:.|.:.|.|....::....|:.:..:....::.:|:|.::|:
  Fly   315 LLLKERVDWS-----NLMLNERMISGIMGQSFNMSARNTISSKVTNATLFLLGLVLSTLYAAHLK 374

  Fly   387 SFMWGPPIDPKMCSFADLENSRYKLAIRRYDIEMLRPFNVSMDHVVVFDESSQLEYLRDSFDDNY 451
            :.:...|...::.:|..|.:|                      .|.||.|.::..||:.::|...
  Fly   375 TLLTKRPTSQQISNFKQLRDS----------------------PVTVFFEEAERFYLKHAWDRPI 417

  Fly   452 MY------------------------PMSALS--WSAFKEQQKLFAFPLFYYSEKL-CLKPISFF 489
            .|                        ..|||:  |....::|:||..|:|....:| .::.....
  Fly   418 RYIKDQLNFRETIEYNALRMGLNRSNAFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLL 482

  Fly   490 SFPIRRHLPYRDLFEEHMLQQNEFGLSTYWIDRSFSDMVRLKLATMNDFSPPRLEDYIEVSDLSW 554
            |..::.:..|.|...:.:.:....|:..||..::..:|:.:.:.:..|..|.......:|.||.|
  Fly   483 SLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFPYVAFREFKVGDLFW 547

  Fly   555 VFGMYFTGLGISCCCFGLELL 575
            ::.::.:.|.:|...|..|||
  Fly   548 IWLLWVSFLFMSFVIFLCELL 568



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.