DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir48c

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_610700.1 Gene:Ir48c / 36257 FlyBaseID:FBgn0033651 Length:561 Species:Drosophila melanogaster

Alignment Length:655 Identity:131/656 (20%)
Similarity:242/656 (37%) Gaps:179/656 (27%)


  Fly     1 MVRIIIILLCLGYTKARILDATNTNHTDLEERLLSLLLRLQQEQFFNTLLIYGEDCAFSSLSRRL 65
            ::|||:|::.|                    |::|.:                .|...|.||..|
  Fly     3 LLRIILIIIFL--------------------RIVSSI----------------PDTIISHLSAEL 31

  Fly    66 QVP-TILVSSGSTSFEW-----NYSSLALI--LTCEFKAEREENYQTLKKLQMNRRLILLNGNIK 122
            |:. .|....|:..:::     ||..:.:.  ::.|||...:|....:.:|:.:     ||.|:.
  Fly    32 QIKIQIYFGLGNDLYDFSRLDGNYQKIIISHNISEEFKTYHDEPVLIIIRLERD-----LNLNLA 91

  Fly   123 PDSVCDFYSKKDQYN-IAMVNNN------------------FHQVGIIYACRLFQERNYE----- 163
            ...|...|....||| |.:::|:                  |.|| :||..   |:|.:.     
  Fly    92 TLDVLRSYLTDRQYNDILLIDNDEENLNSYVDIRKAYWNAGFSQV-LIYNS---QQRTWSIKPYP 152

  Fly   164 ---------KVYLSEGNPIYVDQFRNMQGALLKSITFNLIPGSMAYRDPKTGQ-EKHIGYVANLL 218
                     |.|:...|.      ||:.|..|:.:..|..|.....:|...|. .::.|.:..:|
  Fly   153 YLQIRPTSLKEYIENRNT------RNLMGYPLRVLVTNDPPHCFVDKDELPGSPNRYKGSIVTML 211

  Fly   219 NNFVEKVNATLDMQVKLHKAGKKTSFYNITKWASEDLVDIGMSYAAYFEMTNFDTISYPYLMTST 283
            ..|.:::|||  .|....:..::.|..:..:..|:|.:|   :..:.|..|.....|.|..:...
  Fly   212 KIFADQLNAT--FQANPFREFRRYSTADCVQMVSDDEID---ACGSIFIRTYTYATSQPVRLNRV 271

  Fly   284 CFMVPLPDMMPNSEIYMGI--------VDPPVLVVLIAIFCIFSVMLNYIKQRSWR----SLSLV 336
            ..|.|..:  |..:.|...        :...::||.||   :...:|:....:.|.    .|..|
  Fly   272 VIMAPFGN--PIEKFYYFFRPFDLYVWIGTGIIVVYIA---VMGSLLHRWHFKEWNVGQYLLLAV 331

  Fly   337 NVLLNDICLRGFLAQPFPFPRQSNRKLKLISMLVCFFSVITTTMYTSYLQSF----MWGPPIDPK 397
            ..|||         :....|:.|:....::.:|:.....|.:.:|.:.|...    ::..||:  
  Fly   332 QTLLN---------RELSLPQSSSGSKFMLLLLLFAIGFILSNLYVALLSMMLTTKLYQRPIE-- 385

  Fly   398 MCSFADLENSRYKLAIRRYDIEMLRPFNV------SMDHVVVFDESSQLEYLRDSFDDNYMYPMS 456
              :.|||:.:...:.::.::|   ||.:|      ..:..::.:||..|| .|:..|.:|.|..|
  Fly   386 --NLADLKAANVNILLQTHNI---RPNSVYGSSEELRERFLLVEESQHLE-KRNGLDPSYAYVDS 444

  Fly   457 ALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFF--------SFPIRRHLPYRDLFEEHMLQQNEF 513
            ......:..|||.    |.....|....|:.:.        ::.:.:|      :.:|:.:..|.
  Fly   445 EDRMDFYLYQQKF----LRRRRMKKLSNPVGYTWAVQVIKQNWVLEKH------YNDHVQRFFET 499

  Fly   514 GLSTYWIDRSFSDM--VRLKLATMNDF-------SPPRLEDYIEVSDLSWVFGMYFTGLGISCCC 569
            ||....:|    |:  :.:|...::.|       .|.||||.:..   :.|.|   .|..::..|
  Fly   500 GLQNKLVD----DVHELAVKAGFLHFFPTQTQTIEPLRLEDIVMA---AMVLG---GGHALAVIC 554

  Fly   570 FGLEL 574
            |.:||
  Fly   555 FLVEL 559



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.