DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir11a

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster

Alignment Length:200 Identity:50/200 (25%)
Similarity:78/200 (39%) Gaps:56/200 (28%)


  Fly    33 LLSLLLR-LQQEQFFNTLLIYGEDCAFSSLSRRLQVPTILVSSGSTSFEWNYSSLA--------L 88
            ||:|:|| ..|.:.|:.|          .|||...:|..|    |...:.||:.:|        |
  Fly   433 LLTLVLRCAYQARLFDVL----------RLSRHRPLPKDL----SGLIKDNYTMVANGYHDFYPL 483

  Fly    89 ILTCEFKAEREENYQTLKKLQMNRRL--ILLNGNIKPDSVCDFYSKKDQYNIAMVN------NNF 145
            .|||....:....::.:::...:.||  |.|..|:.       |......||:.:.      ..:
  Fly   484 ELTCRQPLDFSARFERVQRAAPDERLTTIALISNLA-------YWNHKHPNISRLTFVRQPIYMY 541

  Fly   146 HQVGIIYACRLFQER----NYEKVYLSEGNPIYVD----QFRNMQ------GALLKSITFNLIPG 196
            |.|  ||..|.|..|    ...|..||.|...:::    |:.|.:      ..||:.||.:::.|
  Fly   542 HLV--IYFPRRFFLRPAIDRKIKQLLSAGVMAHIERRYMQYENKRKVASNDPVLLRRITKSIMNG 604

  Fly   197 SMAYR 201
              |||
  Fly   605 --AYR 607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir52dNP_611042.2 None
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.