DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir7c

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster

Alignment Length:477 Identity:100/478 (21%)
Similarity:170/478 (36%) Gaps:119/478 (25%)


  Fly   172 PIYVDQFRNMQGALLKSITFNLIPGSMAYRDPKT--GQEKHIGYVANLLNNFVEKVNATLDMQVK 234
            |::..:..||.|..:...||...|..:...||||  |:..| |....:..:..|::|.|    :|
  Fly   202 PLFPRKLTNMHGCEMVVATFEHRPYVIIEDDPKTPGGRSIH-GIEGLIFRSLAERMNFT----IK 261

  Fly   235 LHKAGKKT--------SFYNITKWASEDLVDIGMSYAAYFEMTNFDTISYPYLMTSTCFMV--PL 289
            |.:...|.        :|..|.|...:..|:                      :|..|||.  ..
  Fly   262 LVEQKDKNRGEILPDGNFTGILKMMVDGEVN----------------------LTFVCFMYSKAR 304

  Fly   290 PDMMPNSEIYMGIVDPPVLVV----LIAIFCIFSVMLNYIKQRSWRSLSLVNVLLND--ICLRGF 348
            .|:|..|..|...  |.||||    .|:.....:....||   .| |..||:::...  |||...
  Fly   305 SDLMLPSTSYTSF--PIVLVVPSGGSISPMGRLTRPFRYI---IW-SCILVSLIFGFVLICLLKI 363

  Fly   349 LAQP------------FPF---------------PRQSNRKLKLISMLVCFFSVITTTMYTSYLQ 386
            .|.|            .||               |:::..:..|:..|:  .::|....||..|.
  Fly   364 TALPGLRNLVLGRRNRLPFMGMWASLLGGLALYNPQRNFARYILVMWLL--QTLILRAAYTGQLY 426

  Fly   387 SFMWGPPIDPKMCSFADLENSRYKLAIRRYDIEMLRP-FNVSMD----HVVVFDESSQLEYLRDS 446
            ..:....:...:.|.:::....|:..|    :..||. |..||.    |.|:..|.| |..|||.
  Fly   427 LLLQDVEMRSPIKSLSEVLAKDYEFRI----LPALRTIFKDSMPTTNFHAVLSLEES-LYRLRDE 486

  Fly   447 FDDN----YMYP-MSALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFFSFPIRRHLPYRDLFEEH 506
            .|..    .:.| ::...:.:...::.|...|     :.|...|::|:   :|.|..::...:..
  Fly   487 DDPGITVALLQPTVNQFDFRSGPNKRHLTVLP-----DPLMTAPLTFY---MRPHSYFKRRIDRL 543

  Fly   507 MLQQNEFGLSTYWIDRSFSDMVRLKLATMNDFSPPRLEDYIEVSDLSWVFGMYFTGLGISCCCFG 571
            ::.....|:...: .:.:.|.:: :::...:..|..|.        .|...      ||..||.|
  Fly   544 IMAMMSSGIVARY-RKMYMDRIK-RVSKRRNLEPKPLS--------IWRLS------GIFVCCAG 592

  Fly   572 LELLGLPSWTRRLRLTNWLRVR 593
            |.|:.|..:...:..||..|:|
  Fly   593 LYLVALIVFILEILTTNHRRLR 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir52dNP_611042.2 None
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 17/67 (25%)
Lig_chan 343..593 CDD:278489 53/282 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.