DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir7b

DIOPT Version :8

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster

Alignment Length:747 Identity:129/748 (17%)
Similarity:238/748 (32%) Gaps:272/748 (36%)


  Fly     5 IIILLCLGYTKARILDATNTNHTDLEERLLSLLLRLQQEQFFNTLLIYGE--------------D 55
            :.||.|.....:.:   .:::..||.|.|..::...:..: |.||.||..              |
  Fly     5 LYILSCCSLVASTM---ESSSDWDLAEALAQVVANSEMGR-FKTLYIYTHTNSQSTGGHLEELLD 65

  Fly    56 CAFSSLSRRLQVPTILVSSGSTSFEWNYSSLALI-------------------------LTCEFK 95
            .....:...||...:|:........:.::.|||:                         ::....
  Fly    66 QVLMIVPNNLQARRLLLQQSMEYKPYVHAVLALVDGLPSLSAIYARIRATQDLSHTLIYMSMPTD 130

  Fly    96 AEREENYQTLKKLQMNRRLILLNGNI--KP--DSV-------------CDFYSKK--DQYNIAMV 141
            |..||...||:.|.   ||.:||..:  :|  |.:             |...|..  ::|.:...
  Fly   131 AYGEEMQATLRFLW---RLSVLNVGVVLRPPGDHILMVSYFPFSALHGCQVISANVVNRYQVGTK 192

  Fly   142 N-----------NNFHQVGIIYACRLFQERNYEKVYLSEGNPIYVDQFRNMQGALLKSITFNLIP 195
            .           .||:  |.:..|..:::..| .|:..:|:..:|    .::||||:.:..||  
  Fly   193 RWASQDYFPSKLGNFY--GCLLTCATWEDMPY-LVWRPDGSGSFV----GIEGALLQFMAENL-- 248

  Fly   196 GSMAYRDPKTGQEKHIGYVANLLNNFVEKVNATLDMQVKL------HKAGKKTSFYNITKWASED 254
                            .:...|.....|:|.||.|...::      |.|......::....|.. 
  Fly   249 ----------------NFTVGLYWMNKEEVLATFDESGRIFDEIFGHHADFSLGGFHFKPSAGS- 296

  Fly   255 LVDIGMSYAAYFEMTN-------------FDTISYPYLMTSTCFMVPLPDMMPNSEIYMGIVDPP 306
              :|..|.:.|:.|::             ::.:|:|:                          .|
  Fly   297 --EIPYSQSTYYFMSHIMLVTNLQSAYSAYEKLSFPF--------------------------TP 333

  Fly   307 VLVVLIAIFCIFSVMLNYIKQRSWRSLSLVNVLLNDICLRGFL----AQPFPFPRQSNRKLKLIS 367
            :|                     ||::.||.:|   .||...|    ......||....:|.:::
  Fly   334 LL---------------------WRAIGLVLIL---ACLLLMLLVRWRHHHELPRNPYYELLVLT 374

  Fly   368 M----------------LVCFFSVITTTMYTSYLQSFMW---------GPP--IDPKMCSFADLE 405
            |                ||....:..|.:..|..||.|:         .||  |...:.....::
  Fly   375 MGGNLEDRWVPQRFPSRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQ 439

  Fly   406 NSRYKLAIRRYDIEMLRPFNVSMDHVVVFDESSQLEYLRDSFDDNYMYPMSALSWSAFKEQQKLF 470
            .:....|.....:..|||      ..:|:.|.|:|:    ||        .||:..:....:...
  Fly   440 LAEVNEARILASLPELRP------EQLVYLEGSELQ----SF--------PALAQQSGSSARVAI 486

  Fly   471 AFPLFYYS----------------EKLCLKPISFFSFPIRRHLPYRDLFEEHMLQQNEFGLSTYW 519
            ..|..|:.                |::..:.::|:   :|||.....:..:.:...:..|...:|
  Fly   487 LTPYEYFGYFRKVHPMSRRLHLVRERIYTQQLAFY---VRRHSHLVGVLNKQIQHAHTHGFLEHW 548

  Fly   520 I----------DRSFSDMVRLKLATMN--DFSP------------PRLEDYIEVSDLSWVFGM-Y 559
            .          |.|.:.:.....:|::  |..|            |..::.:.:.:|:.:|.: .
  Fly   549 TRQYVSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLIL 613

  Fly   560 FTGLGISCCCFGLELLGLPSWTRRLRLTNWLR 591
            :..|| :...|.|||| ||    |::|...||
  Fly   614 WANLG-AVVVFVLELL-LP----RIKLRKILR 639



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.