DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8160 and DSK2

DIOPT Version :8

Sequence 1:NP_611031.3 Gene:CG8160 / 36701 FlyBaseID:FBgn0034011 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_179311.1 Gene:DSK2 / 816225 AraportID:AT2G17200 Length:551 Species:Arabidopsis thaliana

Alignment Length:176 Identity:42/177 (24%)
Similarity:52/177 (29%) Gaps:42/177 (24%)


  Fly    39 SGYGSSPSGYG--------------GSASQSGQGGYGGGQGGYG---GGQGGYGGGQGGYGGG-- 84
            |...|.|.|:.              .:.:.||..|...|...:.   |.||....|.......  
plant   245 SNIESMPEGFNMLRRMYENVQEPLMNATTMSGNAGNNTGSNPFAALLGNQGVTTQGSDASNNSST 309

  Fly    85 -QGGYGGVQGGYGQPAPLTEQVGY----GGTQGGYGSAQKGYGASVPPNEFALGLSGQGRLGGYG 144
             ..|.|.:......|.|.....|.    |.|..|..:...|.|          ||.|.|.|||.|
plant   310 PNAGTGTIPNANPLPNPWGATGGQTTAPGRTNVGGDARSPGLG----------GLGGLGSLGGLG 364

  Fly   145 NATPQSGKLGYGGGQGGYRRPAPQSGQLYAAGELGAGPQLVQGEFS 190
            ..    |.||.....|.    .|.:.||....:..|..|::|..||
plant   365 GL----GMLGADSPLGA----TPDASQLSQLLQNPAISQMMQSVFS 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8160NP_611031.3 None
DSK2NP_179311.1 UBQ 20..87 CDD:214563
UBL 22..88 CDD:176364
STI1 383..418 CDD:128966 7/21 (33%)
UBA_PLICs 508..547 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.