DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8160 and Ubqln1

DIOPT Version :8

Sequence 1:NP_611031.3 Gene:CG8160 / 36701 FlyBaseID:FBgn0034011 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_446199.2 Gene:Ubqln1 / 114590 RGDID:620745 Length:582 Species:Rattus norvegicus

Alignment Length:96 Identity:26/97 (27%)
Similarity:32/97 (33%) Gaps:25/97 (26%)


  Fly    99 APLTEQ----VGYGGTQGGYGSAQKGYGASVPPNEFALGLSGQGRLGGYGNATPQSGKLGYGGGQ 159
            ||.|.|    .|..|:.....|...|...|.|        :|||..|  .|..|       |.|.
  Rat   316 APQTPQSSPASGSTGSTTNTVSTSAGNATSTP--------AGQGTSG--PNLVP-------GAGA 363

  Fly   160 GGYRRPAPQSGQLYAAGELGAGPQLVQGEFS 190
            ..:..|..||    ...::...|||:|...|
  Rat   364 SMFNTPGMQS----LLQQITENPQLMQNMLS 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8160NP_611031.3 None
Ubqln1NP_446199.2 UBQ 28..98 CDD:214563
hPLIC_N 28..98 CDD:176403
Interaction with UBXN4. {ECO:0000250|UniProtKB:Q9UMX0} 169..422 26/97 (27%)
STI1 173..210 CDD:128966
TFIIA 285..>447 CDD:281188 26/97 (27%)
STI1 384..416 CDD:128966 3/8 (38%)
UBA_PLICs 539..578 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.