DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-51L2 and CI51

DIOPT Version :8

Sequence 1:NP_725449.1 Gene:ND-51L2 / 36695 FlyBaseID:FBgn0034007 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_196470.1 Gene:CI51 / 830752 AraportID:AT5G08530 Length:486 Species:Arabidopsis thaliana

Alignment Length:472 Identity:226/473 (48%)
Similarity:293/473 (62%) Gaps:12/473 (3%)


  Fly    12 SVWEQQLRL---VQTAKKAGGSKKLGPDRPPIIDPPKGYEPNCKTKFGPLDDCDRVFQNLYGRHD 73
            |:|::..||   :::......|....|..||...||:      ||.||.|.|.||:|.||||.||
plant    15 SIWKESNRLTPALRSFSTQAASTSTTPQPPPPPPPPE------KTHFGGLKDEDRIFTNLYGLHD 73

  Fly    74 WRLHGACQRGDWHRTAELLEQGPEWIMKQVSKSGLRGRGGAGFYAGLKWEFLRQTKSEKVPKMVI 138
            ..|.||.:|||||||.:|:.:|.:||:.::.||||||||||||.:||||.|:.:. |:..|..::
plant    74 PFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKV-SDGRPSYLV 137

  Fly   139 VNCAEGEPGTCKDRDILRHEPHKLIEGILLVGVAMGCGRAIVYIRNRFYNEACNLHFALAEAYHH 203
            ||..|.||||||||:|:||:||||:||.|:.||.|....|.:|||..:.||..||..|..|||..
plant   138 VNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARREAYAA 202

  Fly   204 GLLGNSVCGTGIKFDVMVQRG-DRYLCGEETAMINCLMGKLGRPRRRPPFLTEKGYFEHPCLVIN 267
            ||||.:.||:|..|:|.:..| ..|:||||||::..|.||.|:||.:|||....|.:..|..|.|
plant   203 GLLGKNACGSGYDFEVYIHFGAGAYICGEETALLESLEGKQGKPRLKPPFPANAGLYGCPTTVTN 267

  Fly   268 AESIAVVPTILRRGSQWWAGLGRSYNTGTKLYCLSGQVNNPCTVEEEMSIPLKDLIERHAGGVKG 332
            .|::||.|||||||.:|::..||..|.||||:|:||.||.|||||||||||||:|||||.|||:|
plant   268 VETVAVSPTILRRGPEWFSSFGRKNNAGTKLFCISGHVNKPCTVEEEMSIPLKELIERHCGGVRG 332

  Fly   333 GWDNLAAVFPGGLSTPLLDPSTAGKVLMDFDSLTDAGSGFGCGAVIVMTKDCDPLAIMLRSIQFF 397
            |||||.|:.|||.|.||:..:....||||||:|....||.|..|||||.|..|.:..:.|...|:
plant   333 GWDNLLAIIPGGSSVPLIPKNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFY 397

  Fly   398 EKHTCKQCSYCRDGAIWLPEIFARFVKGQTHPHEIDWTLVIADKMRNSKPICALAYSQVSVAESL 462
            :..:|.||:.||:|..||..|..|...|.....||| .|....|......||||..:.....:.|
plant   398 KHESCGQCTPCREGTGWLWMIMERMKVGNAKLEEID-MLQEVTKQIEGHTICALGDAAAWPVQGL 461

  Fly   463 VRMFSRKIEERLLKYAK 479
            :|.|..::|.|:.:.|:
plant   462 IRHFRPELERRIRERAE 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-51L2NP_725449.1 PTZ00304 55..477 CDD:185547 213/423 (50%)
Complex1_51K 103..275 CDD:279808 88/173 (51%)
SLBB 298..>335 CDD:287499 30/37 (81%)
NADH_4Fe-4S 389..466 CDD:287548 24/77 (31%)
CI51NP_196470.1 PLN03132 26..465 CDD:178678 218/447 (49%)
Complex1_51K 103..272 CDD:279808 86/170 (51%)
SLBB 298..350 CDD:287499 40/52 (77%)
NADH_4Fe-4S 389..465 CDD:287548 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D549172at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11780
Phylome 1 0.910 0.667 Consistency score
33.020

Return to query results.
Submit another query.