DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-51L2 and ndufv1

DIOPT Version :8

Sequence 1:NP_725449.1 Gene:ND-51L2 / 36695 FlyBaseID:FBgn0034007 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001003747.1 Gene:ndufv1 / 445291 ZFINID:ZDB-GENE-040808-73 Length:492 Species:Danio rerio

Alignment Length:439 Identity:231/440 (53%)
Similarity:295/440 (67%) Gaps:13/440 (3%)


  Fly    42 DPPKGYEPNCKTKFGPLDDCDRVFQNLYGRHDWRLHGACQRGDWHRTAELLEQGPEWIMKQVSKS 106
            :.||      |||||||.|.||:|.||||||||||.||.:||||::|.|:|::|.:||:.::..|
Zfish    56 ETPK------KTKFGPLADQDRIFTNLYGRHDWRLKGALRRGDWYKTKEILDKGVDWILNEIKTS 114

  Fly   107 GLRGRGGAGFYAGLKWEFLRQTKSEKVPKMVIVNCAEGEPGTCKDRDILRHEPHKLIEGILLVGV 171
            ||||||||||..|:||.|:.: .|:..||.::||..||||||||||:|:|::|||||||.|:.|.
Zfish   115 GLRGRGGAGFPTGMKWSFMNK-PSDGRPKYLVVNADEGEPGTCKDREIMRNDPHKLIEGCLVAGR 178

  Fly   172 AMGCGRAIVYIRNRFYNEACNLHFALAEAYHHGLLGNSVCGTGIKFDVMVQRG-DRYLCGEETAM 235
            |||...|.:|||..||||:.||..|:.|||..||:|.:.||:|..|||.|.|| ..|:||||||:
Zfish   179 AMGARAAYIYIRGEFYNESSNLQVAINEAYAAGLIGKNACGSGYDFDVFVMRGAGAYICGEETAL 243

  Fly   236 INCLMGKLGRPRRRPPFLTEKGYFEHPCLVINAESIAVVPTILRRGSQWWAGLGRSYNTGTKLYC 300
            |..:.||.|:||.:|||..:.|.|..|..|.|.|::||.|||.|||..|:||.||..|:||||:.
Zfish   244 IESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVAPTICRRGGTWFAGFGRERNSGTKLFN 308

  Fly   301 LSGQVNNPCTVEEEMSIPLKDLIERHAGGVKGGWDNLAAVFPGGLSTPLLDPSTAGKVLMDFDSL 365
            :||.||||||||||||||||:|||||||||:||||||..|.|||.||||:.......||||||:|
Zfish   309 ISGHVNNPCTVEEEMSIPLKELIERHAGGVRGGWDNLLCVIPGGSSTPLIPQHVCDTVLMDFDAL 373

  Fly   366 TDAGSGFGCGAVIVMTKDCDPLAIMLRSIQFFEKHTCKQCSYCRDGAIWLPEIFARFVKGQTHPH 430
            ..|.:|.|..|:|||.|..|.:..:.|.|:|::..:|.||:.||:|..|:.::..|||||.....
Zfish   374 IQAQTGLGTAALIVMDKSTDVIRAIARLIEFYKHESCGQCTPCREGVDWMNKMMWRFVKGDARSA 438

  Fly   431 EID--WTLVIADKMRNSKPICALAYSQVSVAESLVRMFSRKIEERLLKY 477
            |||  |.:   .|......||||........:.|:|.|...:|.|:..:
Zfish   439 EIDMIWEI---SKQIEGHTICALGDGAAWPVQGLIRHFRPLMESRIADF 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-51L2NP_725449.1 PTZ00304 55..477 CDD:185547 226/425 (53%)
Complex1_51K 103..275 CDD:279808 94/173 (54%)
SLBB 298..>335 CDD:287499 31/37 (84%)
NADH_4Fe-4S 389..466 CDD:287548 26/79 (33%)
ndufv1NP_001003747.1 PRK13596 66..487 CDD:237441 223/424 (53%)
Complex1_51K 111..280 CDD:279808 92/170 (54%)
SLBB 306..358 CDD:287499 42/52 (81%)
NADH_4Fe-4S 397..478 CDD:287548 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C282339009
eggNOG 1 0.900 E1_COG1894
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D272111at33208
OrthoFinder 1 1.000 FOG0002794
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11780
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.