DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-51L2 and Ndufv1

DIOPT Version :8

Sequence 1:NP_725449.1 Gene:ND-51L2 / 36695 FlyBaseID:FBgn0034007 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001006973.1 Gene:Ndufv1 / 293655 RGDID:1359247 Length:464 Species:Rattus norvegicus

Alignment Length:431 Identity:230/432 (53%)
Similarity:295/432 (68%) Gaps:7/432 (2%)


  Fly    52 KTKFGPLDDCDRVFQNLYGRHDWRLHGACQRGDWHRTAELLEQGPEWIMKQVSKSGLRGRGGAGF 116
            ||.||.|.|.||:|.||||||||||.||.:||||::|.|:|.:||:||:.::..|||||||||||
  Rat    29 KTSFGSLKDEDRIFTNLYGRHDWRLKGAQRRGDWYKTKEILLKGPDWILGEMKTSGLRGRGGAGF 93

  Fly   117 YAGLKWEFLRQTKSEKVPKMVIVNCAEGEPGTCKDRDILRHEPHKLIEGILLVGVAMGCGRAIVY 181
            ..||||.|:.: .|:..||.::||..||||||||||:|:||:||||:||.|:.|.|||...|.:|
  Rat    94 PTGLKWSFMNK-PSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIY 157

  Fly   182 IRNRFYNEACNLHFALAEAYHHGLLGNSVCGTGIKFDVMVQRG-DRYLCGEETAMINCLMGKLGR 245
            ||..|||||.||..|:.|||..||:|.:.|.:...|||.|.|| ..|:||||||:|..:.||.|:
  Rat   158 IRGEFYNEASNLQVAIREAYEAGLIGKNACDSDYDFDVFVVRGAGAYICGEETALIESIEGKQGK 222

  Fly   246 PRRRPPFLTEKGYFEHPCLVINAESIAVVPTILRRGSQWWAGLGRSYNTGTKLYCLSGQVNNPCT 310
            ||.:|||..:.|.|..|..|.|.|::||.|||.|||..|:||.||..|:||||:.:||.||:|||
  Rat   223 PRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCT 287

  Fly   311 VEEEMSIPLKDLIERHAGGVKGGWDNLAAVFPGGLSTPLLDPSTAGKVLMDFDSLTDAGSGFGCG 375
            ||||||:|||:|||:|||||.||||||.||.|||.||||:..|....||||||:|..|.:|.|..
  Rat   288 VEEEMSVPLKELIEKHAGGVLGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTA 352

  Fly   376 AVIVMTKDCDPLAIMLRSIQFFEKHTCKQCSYCRDGAIWLPEIFARFVKGQTHPHEID--WTLVI 438
            |||||....|.:..:.|.|:|::..:|.||:.||:|..|:.::.||||||...|.|||  |.:  
  Rat   353 AVIVMNSSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEI-- 415

  Fly   439 ADKMRNSKPICALAYSQVSVAESLVRMFSRKIEERLLKYAK 479
             .|......||||........:.|:|.|..::|:|:.::|:
  Rat   416 -SKQIEGHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQ 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-51L2NP_725449.1 PTZ00304 55..477 CDD:185547 227/425 (53%)
Complex1_51K 103..275 CDD:279808 94/173 (54%)
SLBB 298..>335 CDD:287499 28/37 (76%)
NADH_4Fe-4S 389..466 CDD:287548 28/79 (35%)
Ndufv1NP_001006973.1 PRK13596 35..453 CDD:237441 225/422 (53%)
Complex1_51K 80..249 CDD:279808 92/170 (54%)
SLBB 275..327 CDD:287499 40/52 (77%)
NADH_4Fe-4S 366..447 CDD:287548 29/84 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C282337808
eggNOG 1 0.900 E1_COG1894
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D272111at33208
OrthoFinder 1 1.000 FOG0002794
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11780
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.