DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-51L2 and SPBC18E5.10

DIOPT Version :8

Sequence 1:NP_725449.1 Gene:ND-51L2 / 36695 FlyBaseID:FBgn0034007 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_595857.1 Gene:SPBC18E5.10 / 2540740 PomBaseID:SPBC18E5.10 Length:452 Species:Schizosaccharomyces pombe

Alignment Length:416 Identity:149/417 (36%)
Similarity:224/417 (54%) Gaps:5/417 (1%)


  Fly    63 RVFQNLYGRHDWRLHGACQRGDWHRTAELLEQGPEWIMKQVSKSGLRGRGGAGFYAGLKW-EFLR 126
            |:|.||..:...|:..|...|::...:|:|:..|..|::.|.:|.|||||..||..|.|. ...:
pombe    33 RMFPNLIEKRIRRIDDALADGEYENLSEILKYDPLNIIELVQESELRGRGRYGFPTGEKMLSLYK 97

  Fly   127 QTKSEKVPK---MVIVNCAEGEPGTCKDRDILRHEPHKLIEGILLVGVAMGCGRAIVYIRNRFYN 188
            .|.||:..|   :||||.||.:.|:.|||.:|||||||:|||.::...|:......::||..:|.
pombe    98 ATSSERGRKEKPVVIVNAAENDIGSFKDRLLLRHEPHKIIEGAIIAARAVEASACYLFIRKDYYE 162

  Fly   189 EACNLHFALAEAYHHGLLGNSVCGTGIKFDVMVQRG-DRYLCGEETAMINCLMGKLGRPRRRPPF 252
            |...:...:.:||...|||.::.||.|..::::..| ..|:.|||:|:|..|.|:...|......
pombe   163 ETVMMQKCIIQAYAKKLLGKNLLGTSIGLELLIHPGAGSYITGEESALIQSLQGEFPVPDIPINN 227

  Fly   253 LTEKGYFEHPCLVINAESIAVVPTILRRGSQWWAGLGRSYNTGTKLYCLSGQVNNPCTVEEEMSI 317
            ....|.|..|.||:|.|:::.:|.|:::|.:::..:||..|.||||:.:||:||.|..:|..|||
pombe   228 TITSGLFGLPTLVLNVETVSNLPAIIKKGPKFFISMGRPNNRGTKLFSISGEVNEPNVIEACMSI 292

  Fly   318 PLKDLIERHAGGVKGGWDNLAAVFPGGLSTPLLDPSTAGKVLMDFDSLTDAGSGFGCGAVIVMTK 382
            |||||||.:||||:|||:.|..:||||..:.:|:.:...:|.||||||....|..|.|:|||:..
pombe   293 PLKDLIENYAGGVRGGWNKLVGIFPGGPCSGILNKNQCEQVTMDFDSLKALDSSLGTGSVIVLND 357

  Fly   383 DCDPLAIMLRSIQFFEKHTCKQCSYCRDGAIWLPEIFARFVKGQTHPHEIDWTLVIADKMRNSKP 447
            .......:|...:|:..:||..|..||||...:.|.......|..|..::.......:...:||.
pombe   358 HDQIFESLLNFAKFYSTNTCHTCPVCRDGVEDVIETLKGLKDGHAHLSQLKDMFSKFNMPSSSKV 422

  Fly   448 ICALAYSQVSVAESLVRMFSRKIEER 473
            .|....|......|:.|.|..:|..|
pombe   423 FCGFGDSMRHQIHSIQRNFPDQITFR 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-51L2NP_725449.1 PTZ00304 55..477 CDD:185547 149/417 (36%)
Complex1_51K 103..275 CDD:279808 65/177 (37%)
SLBB 298..>335 CDD:287499 24/37 (65%)
NADH_4Fe-4S 389..466 CDD:287548 18/77 (23%)
SPBC18E5.10NP_595857.1 NuoF 21..452 CDD:224806 149/417 (36%)
Complex1_51K 73..250 CDD:279808 65/177 (37%)
SLBB 273..323 CDD:287499 29/50 (58%)
NADH_4Fe-4S 365..445 CDD:287548 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 303 1.000 Inparanoid score I586
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002794
OrthoInspector 1 1.000 T631376
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11780
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
77.030

Return to query results.
Submit another query.