DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trpm and trpm6

Sequence 1:NP_001097320.1 Gene:Trpm FlyBaseID:FBgn0265194 Length:2023 Species:Drosophila melanogaster
Sequence 2:XP_002940079.2 Gene:trpm6 XenbaseID:XB-GENE-958179 Length:2001 Species:Xenopus tropicalis

Alignment Length:1852 Identity:630/1853 (34%)
Similarity:934/1853 (50%) Gaps:320/1853 (17%)


  Fly   115 RSWIETNFQKRECIKFIPCPKDD-------------TKCCCGQAQITHQTIPGIESGSP------ 160
            :||||..|.||||.|.||..|:.             .:||||:....|   ||::.|.|      
 Frog     9 KSWIEGLFNKRECAKIIPSSKEPHRCHGGCQVCQNLIRCCCGRLIGDH---PGLDYGWPINPSPQ 70

  Fly   161 ---GDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLL 222
               .:.|....||:|.||||:|||.||.|.|...|:|:|:|:||..|||:.|..|||.:|||||:
 Frog    71 EREDEEWSILNHTKPSPTDAFGTINFQDGDHTYHAKYIRISYDTTLELLMHLMIKEWQMELPKLV 135

  Fly   223 ITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRTGRVVS 287
            |:|.||..||.|.:|:|:...|||:|||:||||||.|.|.|||.:|.|||||.....|...::.:
 Frog   136 ISVHGGIQNFKLPSKIKQVFGKGLVKAAETTGAWILTEGINTGASKHVGDALKAHASQHLRKICA 200

  Fly   288 IGIAPWGIVERNHELLGHNREVPC--HSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRR 350
            :||.|||.:|...:|:|  ::|.|  .::.:|.|||..||:.|::|::||:||..|||.|:.|||
 Frog   201 VGIPPWGAIENQQDLIG--KDVVCLYQTLINPMSKLTSLNSMHSHFIMVDDGTVGKYGNEMKLRR 263

  Fly   351 KLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVH 415
            .||.|||..|:|.......|||.||||||.|.|..|.|||..:||||||||:|:|||||:|||.|
 Frog   264 NLEDFISLQKIHTRMGQGVPVVGLVIEGGPNVILMVWEYVRSTPPVPVVVCEGTGRAADILAFTH 328

  Fly   416 KYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQ 480
            |:.:|.|:  :...:::.::..|||||.:|..||..:...|::|...:..||:|..:.:   |.|
 Frog   329 KHTTDTEQ--ISPQLKEEILEMIQKTFNLGHRQSNHVLYILMECMERRASITIFDAESE---EQQ 388

  Fly   481 ELDQTILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDF 545
            ::|..|||||.|..::|..:||||||||||||||:..|.:|||.|..|:|::||..||..||:||
 Frog   389 DIDLAILTALLKGTNMSAQDQLSLALTWNRVDIAKKHILIYGQHWKVGSLEQAMQDALVMDRVDF 453

  Fly   546 VKLLLENGVSMKKFLTIPRLEELYNTKHGPAN-TLGYILRDVRPHIPK-GYIYTLHDIGLVINKL 608
            ||||:|.||:|.:||||..||||||||.||.| .|.:::|||:...|. .|..:|.|:||||..|
 Frog   454 VKLLIEYGVNMHRFLTIGHLEELYNTKQGPTNLLLHHLVRDVKQSNPSPDYRISLIDVGLVIEYL 518

  Fly   609 MGGAYRSYYTRRKFRPIYAKVMNSY---------------------------------------- 633
            :||||||.|||:.||.:|..:...:                                        
 Frog   519 IGGAYRSSYTRKSFRVLYNSLFRKHKKSVPSSSSSLAQSLSHLSINQSSQMSSKLESPESTLHSQ 583

  Fly   634 ----ANAC-RKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLM 693
                |..| ||..|..:|:....:.::...     .:|...|.:|:|:||:||||.|||:||:..
 Frog   584 FFRTAQPCRRKDKTTCHQKSKKKDEVTCTE-----DNEPVGFIYPYNDLLVWAVLMKRQKMAMFF 643

  Fly   694 WTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQ 758
            |.|||||:.|::::||||:||||||.:..:..:..|||:.|:|||......:|:.:::.:.:.|.
 Frog   644 WQHGEEAMVKAVIACKLYRAMAHEAKQSTMVDDTSEELKKYSKEFGQLALDILENAFKMNEQMAM 708

  Fly   759 RLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMPFYI 823
            :|||.:|.:|||.:||.|||::..|..::|.|:|::|.|:|||.|:.||::..|||||:.:|.::
 Frog   709 KLLTYQLKNWSNSTCLKLAVSSTLRPFVSHTCTQMLLTDMWMGRLKMRKHSWLKVILGILLPPFV 773

  Fly   824 RQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDS 888
            ..|:||:|.|:..:||:.|.|                ....|..|..|:...:.|      :||.
 Frog   774 LMLEFKTKAEMSHVPQSLEFH----------------QFSRLYVDPPSLSTKEEH------ITDF 816

  Fly   889 DTAQFREFFNLSEYNEVKQHQP-------LRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTV 946
            |..:.      |:.....|:|.       |.:.:|..|||:|||.|||..::.|:.||::|::||
 Frog   817 DAERG------SKQPGEDQNQKISNGLGILPITRKICEFYSAPIVKFWFHTMVYLAFLMLFTYTV 875

  Fly   947 LVKMEQMPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGL 1011
            ||||:..|..|||..|.||.|...|||||:..|||...:.|..||....||..|..||.||.||.
 Frog   876 LVKMDPQPSVQEWCVIIYIFTTAVEKVREVFVSEPGKFSQKVKVWINEYWNLTDSIAIFLFFIGF 940

  Fly  1012 AFRFRENTMD-IGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMS 1075
            ..|:.:.... .||:|||:|.|:||:|:|:...||:..||.:||:|||..||...|:::|:||::
 Frog   941 GLRWPDPPFQTAGRIIYCLDIIFWYVRLLDFFAVNQQAGPYITMLGKMTSNMFGIVIIMAIVLLA 1005

  Fly  1076 FGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCGEDPSQPGCVTGHWVTPITMS 1140
            |||||:|||.|:..|:|:|.:::.||||:|::|||:||:|| .|.|||.   |..|.::||...:
 Frog  1006 FGVSRKAILSPDHPPSWTLARDIVFQPYWMMFGEVYAGEID-ACEEDPD---CPPGSFITPFLQA 1066

  Fly  1141 MYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLK 1205
            :||.:..|:::||||::|||::..:|||||::|.:.|:..:|.|.:||.||||.|.|.|.|.|:.
 Frog  1067 VYLFVQYIIMVNLLISLFNNVYRVLNSVSHKLWKYNRYRYIMTYYEKPWLPPPLIFLSHIYILIN 1131

  Fly  1206 YCVRKAKGLEV---QRDNGLKLFLEKDDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTER 1267
            .........|.   :.|.||||:|..::|.:|:||||:|||.:|||:...|:.|.:||::.||||
 Frog  1132 RLCHHRSHSEFDPEETDMGLKLYLSDNELRKLHDFEEKCVETYFHEKNESLHSSKNERIRVTTER 1196

  Fly  1268 VETMSQKIEDINQKENIQTATVQNIEFRLRKMEESSEQILSHLAVIHRF--MSTHTAGADDLRGS 1330
            .|.|..:::::|.|......::.:::.:|..:::.|...:..|.:|...  :....|...|.:|.
 Frog  1197 TEEMFAQLKEVNDKVFYIKDSLSSLDSQLGHLQDLSALTVDTLKIISAVDSLQVEEAFIKDKKGL 1261

  Fly  1331 TI--------NIP-GEMQR-----------MRTISISDTEGGSGPGGNGGGGGGGGAIVPLGLGA 1375
            |.        |:| ...||           :||::.|...                         
 Frog  1262 TCKKLPHSWSNVPYSHHQREYNYYSMPPSLLRTLARSQCP------------------------- 1301

  Fly  1376 GLNLNSL------QVTTRRRFNRS---------LTEVRP-DAYIFDEGTHFEVVPL--PEEP--- 1419
                 ||      |:|.:...:.|         :|...| |:.......::.:||.  |..|   
 Frog  1302 -----SLYQCPPQQLTAQLEIHNSEEPKIEVDIVTMAVPLDSKSAQHYGNYLLVPSVGPPAPTDS 1361

  Fly  1420 ------DEVVKSREALNEQVVRKASMQSEADSDIYIPVSQRPSTCETVKRTPYVTVRQDTGASTE 1478
                  .:::...||::.|...|..:.| ..||..:...|:     .||.:...|:::|      
 Frog  1362 AFKETCSDMLSEGEAISVQATTKERICS-IHSDQCLCSKQK-----HVKESSRKTMKED------ 1414

  Fly  1479 SKDTLTPMGNNDDDQTLVGGDNSDDATPDINFEAARHRALRQRTVSLCRRNSETYSLT---GADI 1540
                |.|:..|.|:..   .:.|.:.:.|            |.|..:....|.|.::.   |..:
 Frog  1415 ----LKPLVTNTDESQ---NEESHECSCD------------QFTAHVTVETSITCNIIDPGGGYV 1460

  Fly  1541 NRSHISLNQLASLSRRQMSLTQSEPDSDKDAPIAQGSAHPGKSVLHAKPSR-NILLKLHSEYTSI 1604
            |.:.....:.|..|........|.|...     ::.:..|.||    ..|| |...:..|.|...
 Frog  1461 NLAFSEEGETALFSGGSSKTLCSRPTQS-----SKSNVFPNKS----DGSRANDRPEFGSGYKQK 1516

  Fly  1605 TDELESVCHMIASPTVSLPSNKASLDRPKTEMSRAEAAALLEKKHLKECEENDY-------MILE 1662
            |..|::..:...||..|...:|                   |||..|.|...|:       .:..
 Frog  1517 TSFLKNSLYRNNSPRGSSKRHK-------------------EKKDGKICTIKDFAKPPESSKVTW 1562

  Fly  1663 GLIESRGSIDASAQGFEIGVSIDYSHRYPLRRETAVELSPSKPSVDG---DLMGGGEGGGAGGGD 1724
            ...:.|.:...|.:.                :....:|.....:|||   ......|....|...
 Frog  1563 AKEKLRSTFRKSVKD----------------KPRPTQLQVPVITVDGCSQSTQMSSEPADCGSWK 1611

  Fly  1725 SSDTSGAGSCGAMVGISSGFQLKNERPWQRNSSMEQQTYPSPLVPTRATSDFLNPPYE------- 1782
            |.|.....    .:.:||..||..:........::.|.:...||   .||::|....|       
 Frog  1612 SEDEPSKN----RLTVSSFNQLSLDHMTYMRQQLKTQEFERHLV---QTSEYLRQSREDLHNTTQ 1669

  Fly  1783 ---GRLFKKSSE------SLQKNSSTETDYSA 1805
               ..||:.|.|      ||:.:......|||
 Frog  1670 LRRSSLFRNSDEVKKMAASLKASQDLSNHYSA 1701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TrpmNP_001097320.1 Ion_trans 951..1167 CDD:278921 98/217 (45%)
TRPM_tetra 1262..1313 CDD:293127 11/51 (22%)
trpm6XP_002940079.2 Ion_trans 868..1088 CDD:278921 105/224 (47%)
TRPM_tetra 1191..1242 CDD:293127 11/51 (22%)
Alpha_kinase 1743..1961 CDD:214828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97963311
eggNOG 1 0.900 E1_KOG3614
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323456at33208
OrthoFinder 1 1.000 FOG0000626
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.