DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trpm and trpm6

Sequence 1:NP_001097320.1 Gene:Trpm FlyBaseID:FBgn0265194 Length:2023 Species:Drosophila melanogaster
Sequence 2:NP_001238760.1 Gene:trpm6 ZFINID:ZDB-GENE-111212-1 Length:1875 Species:Danio rerio

Alignment Length:2140 Identity:636/2141 (30%)
Similarity:988/2141 (46%) Gaps:503/2141 (23%)


  Fly   116 SWIETNFQKRECIKFIPCPKDD-------------TKCCCGQAQITH-QTIPGIESGSPG----- 161
            :||:..|.||||::|:|..:|.             .:||||:....| ....|:....||     
Zfish     5 TWIQATFCKRECVRFLPASRDHHRCYPVCQVCQSLVRCCCGRLIAEHVGPYSGLLGHDPGSGSAE 69

  Fly   162 -DLWLPTKHTRPQPTDAYGTIEFQGGA-HPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLIT 224
             :.|...:||....|||:|:::|||.: ...:|:|||||.|:.|||||||..:||::|:|||:||
Zfish    70 EEEWSVLQHTSLSSTDAFGSLDFQGSSKRACRAKYVRLSCDSPPELLVQLMLREWHMEIPKLVIT 134

  Fly   225 VQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRTGRVVSIG 289
            |.||..||.|..::.:....||:.||::|||||.|.|.||||:|.||||:.:.|.....:...:|
Zfish   135 VHGGTDNFLLSPRVCQAFSTGLVTAAESTGAWILTDGINTGVSKYVGDAVKMYGSHDHRKRNVVG 199

  Fly   290 IAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEK 354
            |.||||:|.|.:|:|.:......::.:|.||.|.||..|::|||||:||..|.|.::.||::||:
Zfish   200 ITPWGIIENNSDLIGRDGLRHYQALGNPLSKRASLNGMHSHFLLVDDGTIGKSGCQIELRKRLER 264

  Fly   355 FISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYAS 419
            .|...|:||......|:||:|:|||.:.:..|||||..:.||||:|.:|:|||||:||.:||..:
Zfish   265 HIHYQKIHPRLPQHVPLVCVVVEGGPSVLSVVLEYVCRTSPVPVLVFEGTGRAADMLALIHKQTA 329

  Fly   420 DGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQ 484
              .::.:...:::.::..||.:|.|...:|.:|...|::|..::.||::|   :....:.||.|.
Zfish   330 --VDRKLDSDIKEDVLQRIQDSFGVERSESTELLDILMECMEHRELISIF---DSESEDLQEADV 389

  Fly   485 TILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLL 549
            .||:...:....||.|||||.|.|:|.|||:..|.||||:|..|:|::.|:.||..||::|||||
Zfish   390 AILSTSLRGTRASPEEQLSLTLAWDRADIAKDHILVYGQQWQVGSLEQIMLDALIMDRVNFVKLL 454

  Fly   550 LENGVSMKKFLTIPRLEELYNTKHGPA-NTLGYILRDVR-PHIPKGYIYTLHDIGLVINKLMGGA 612
            :|||::|..||||.|||:|||.:.|.: :.|.:::.|.: ..:|..|..:|.|||:||..|:|||
Zfish   455 IENGMTMSHFLTISRLEQLYNIQTGSSHHFLRHVIADAKQTRLPAVYRISLIDIGMVIEYLIGGA 519

  Fly   613 YRSYYTRRKFRPIYAKVMNSYANAC-----------------------RKSSTYQYQRYAGANSL 654
            |||.|||::||.:|:::.|......                       |.:..|::|.       
Zfish   520 YRSTYTRKRFRTMYSRLHNPAKETSSPFSKAKKVAPAPEATPPRSHFRRTAQPYRHQE------- 577

  Fly   655 SLVTGLLP---FTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAH 716
               .|:.|   .:..:..|...||:|.:||||..||:||||:|.|||:|:|:::|:||||:.:|.
Zfish   578 ---GGVAPQDQKSDPIPDFVCTFNDLFVWAVLKHRQEMALLLWQHGEQAMARAVVACKLYRTLAM 639

  Fly   717 EAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAAN 781
            ||.|.::...:.|||:..:.||......:||.::|::...|.:|||.|:..|||.:||.:||::.
Zfish   640 EAKESNMGDTMAEELKKNSLEFGQLAVDVLDQAFRENERMAMKLLTWEMKDWSNFTCLQMAVSSG 704

  Fly   782 HRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMPFYIRQLDFKSKEELQQMPQTEEE--- 843
            .|..:||.|:|::|.|||||.|...||:.||:|..:.||..|:.|:|||:.|:..:||.:|.   
Zfish   705 LRPFVAHNCTQMLLTDLWMGRLNLSKNSWFKIIGSILMPVAIQLLEFKSQAEMSHVPQLQEALQF 769

  Fly   844 HLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQH 908
            ..:....:.:.::::.|..|               |.|...|                       
Zfish   770 GWDTVPSEQEGAEKAVPGDE---------------ERGSSCL----------------------- 796

  Fly   909 QPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGFEKV 973
              ....:|.|:|||||:.|||..::|::.||:||::|.||::.:.|..||...:.||..:..||.
Zfish   797 --YPWTRKVYDFYTAPVVKFWFHTMAFLGFLMMFAYTCLVRLNETPNIQECLVMTYILAMAVEKA 859

  Fly   974 REIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFRENTMDIGRVIYCVDSIYWYLRI 1038
            ||::..||...|.|..||....||..|...|:||::|::.|:.:.|.....::|.:|.::|.:|:
Zfish   860 REVLVLEPRKFTKKLKVWFSEYWNINDFLGILLFLVGVSLRWHQETRLASHIVYSLDFVFWSVRL 924

  Fly  1039 LNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPY 1103
            |::..||::.||.:||:.||:.||.|.|:::|:||:|||.||::||.||:.|:|:|:::|.||||
Zfish   925 LDLFAVNQHAGPYLTMITKMMSNMFYIVIIMALVLVSFGTSRKSILSPNEDPSWTLLRDVVFQPY 989

  Fly  1104 FMLYGEVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSV 1168
            :|::|||:||:|| .|....:   ||.|.::|....::||.|..|:::|||||.|||::||::::
Zfish   990 WMIFGEVYAGEID-ACANPET---CVPGAFLTIFLQAVYLFIQYIIMVNLLIAFFNNVYNEMSTI 1050

  Fly  1169 SHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRKAKGLEVQRDNGLKLFLEKDDLER 1233
            |.::|.:.|:..:|.||:||.||||.|.|.|....|....:|.:....:...||||.|..|||:|
Zfish  1051 SRKLWKYNRYRYIMTYQEKPWLPPPLIFLSHITLCLSSMWQKHRKASKRGRTGLKLILAPDDLKR 1115

  Fly  1234 LYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFRLRK 1298
            ||:|||:||.|:|.:|:.....|...|:::..::.|.|:..:.::.:|.||....:..::..|.:
Zfish  1116 LYEFEEKCVAGYFRDQKESQQGSQINRIRSAADKAEEMAGILVEVAEKVNIIQDNLHTLDTNLGQ 1180

  Fly  1299 MEESSEQILSHLAVIHRFMSTHTAGADDLRGSTINIPGEMQRMRTISISDTE-------GGSGPG 1356
            :::     ||.|||                 .|:|:         :|.:|.:       |.|.|.
Zfish  1181 LQD-----LSALAV-----------------DTLNL---------LSATDNQQQEVVRLGQSHPH 1214

  Fly  1357 G------------NGGGGGGGGAIVP-------------LGLGAGLNLNSLQVTTRRRFNRSL-- 1394
            .            ..||.......:|             .|||.|          |:|.:..|  
Zfish  1215 ACRHEQVSHSCCLRIGGSVAPSQALPSPKHYRSMPPSLLRGLGPG----------RQRLSMELPP 1269

  Fly  1395 -TEVRPDAYIFDEGTHFEV-----VPLPEEPDEVVK-------SREALNEQVVRKASMQSEADSD 1446
             |.|.|          |||     :..|||.|...:       |||.::              .|
Zfish  1270 GTSVGP----------FEVRSKCLLGSPEEEDCHFRWPLLRGDSREGVS--------------MD 1310

  Fly  1447 IYIPVSQRPSTCETVKRTPYVTVRQDTG--ASTESKDTLTP-----------------MGNNDDD 1492
            .::.:   |..|         |..:|.|  .|.|:....:|                 |...|||
Zfish  1311 CHLSL---PHLC---------TGWRDRGMYGSGEASRASSPNMPLMRDFQLHPSHEESMEEEDDD 1363

  Fly  1493 QTLVGGDNSDDATPDINFEAARHRALRQRTVSLCRRNSETYSLTGADINRSHISLNQLASLSRRQ 1557
            :        ||.          |        ||.|.:|.|:.||                     
Zfish  1364 E--------DDL----------H--------SLSRASSHTFLLT--------------------- 1381

  Fly  1558 MSLTQSEPDSDKDAPIAQGSAHPGKSVL----HAKPSRNILLKLHSEYTSITDELESVCHMIASP 1618
                    |:.:|...|.|..:|....|    |.....::|.:....|     .||.        
Zfish  1382 --------DTQRDMDGAMGIRNPAFYKLDEGGHFLRPHDVLSRKFEAY-----GLEQ-------- 1425

  Fly  1619 TVSLPSNKASLDRPKTEMSRAEAAALLEKKHLKECEENDYMILEGLIESRGSID----ASAQGFE 1679
            :.||.::..|:..|.|..|.......|...|    ..:|:..|..|...:.|..    .|..|..
Zfish  1426 SRSLSASVESMAMPDTSTSEQGRRIYLTPPH----HSHDHKGLSKLFRRQRSFGKKSVRSRAGTP 1486

  Fly  1680 IGVSIDYS----HRYPLRRE--------------TAVELSPSKPSVDGDLMGGGEGGGAGGGDSS 1726
            ..|..|.:    |.:..||:              |:|.|:....                  |..
Zfish  1487 EEVKADETRGRLHEFDSRRKMKRKVKGLFDRRFRTSVSLTQLNV------------------DQV 1533

  Fly  1727 DTSGAGSCGAMVGISSGFQLKNERPWQRNSSMEQQTYPSPLVPTRATSDFLNPPYEGRLFKKSSE 1791
            |.:..    |...:|||..|.:.  |.|  .:.|:...|.:...|:::           ||.:.:
Zfish  1534 DITKL----APSWLSSGQPLLSS--WTR--PISQRPSVSSMTDVRSST-----------FKLTED 1579

  Fly  1792 SLQKNSSTETD---YSAHPYRFIKQSSNETNTSLTGSYNVDTPSLTAEPSLDAGDSHSATGISIS 1853
            ..|..|:.|.:   ..||...|       |..||.|  .|:....|.|.|:  ||..|    |||
Zfish  1580 LGQHYSAMERNNLMRLAHTIPF-------TPVSLLG--GVEVCIYTLEESV--GDPSS----SIS 1629

  Fly  1854 VGAVGGTATARYQPIRTASVGAADGRRLREESS-----SSLDLSSSGPVTMQAAPAPPVRPMLLK 1913
            .....| .||..||:....|  .|| .||..:.     :..|:...|.|.:..|..|.| ..:.:
Zfish  1630 TWLQNG-RTAVLQPLAHQEV--LDG-GLRRATKVVCTWAEGDVLKLGSVYVVKAFRPEV-VRIWQ 1689

  Fly  1914 KQFSV------------------------DQGKPSQTAAEAVPQTPEAAQA--------GQAKLI 1946
            |.|.:                        :|.|||     :||.:|.....        ||...:
Zfish  1690 KVFPISTSLHLCLREIQQQRAAQKLMQRFNQVKPS-----SVPHSPRFLDVSLLHWRSDGQWLTV 1749

  Fly  1947 STLKPQPFASKLGMNVLKE--SSSSTDESV---------------------GSSAKSSNPAL--- 1985
            .......| .|...|..:|  .||..:|::                     |..|..::|:|   
Zfish  1750 ENNMSGHF-RKYNNNTGEEILPSSGLEETILAFSHWTYEYTNKELLVLDLQGVGADLTDPSLIRV 1813

  Fly  1986 ---SIP--------QISTHLVQDEIAKLS----------SNIKSSTESEKD-PPFNETMC 2023
               |.|        .:....:|..:.|.:          |:::|....:|. |.|:||.|
Zfish  1814 DDKSSPGEMAFGPANLGDDAIQSFVLKHTCNSCCKKLGLSDLRSCGSLKKSVPAFDETSC 1873

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TrpmNP_001097320.1 Ion_trans 951..1167 CDD:278921 88/216 (41%)
TRPM_tetra 1262..1313 CDD:293127 11/51 (22%)
trpm6NP_001238760.1 Ion_trans 837..1047 CDD:278921 88/214 (41%)
TRPM_tetra 1144..1195 CDD:293127 13/82 (16%)
Alpha_kinase 1650..1847 CDD:280907 36/205 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97960159
eggNOG 1 0.900 E1_KOG3614
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323456at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13800
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.