DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: scb and ITGAX

Sequence 1:NP_523750.2 Gene:scb FlyBaseID:FBgn0286785 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_001273304.1 Gene:ITGAX HGNCID:6152 Length:1169 Species:Homo sapiens

Alignment Length:1323 Identity:258/1324 (19%)
Similarity:425/1324 (32%) Gaps:472/1324 (36%)


  Fly    50 SSYFGYTLVIRQTS-IIVGAPRAQSTLESQRTINETGAIYRCSLTNGVCSPYVLDSRGNVDAPYS 113
            |:.||.::|....| ::||||      :.....|:||.:|:|..:.|.|.|.      .:..|..
Human    34 SAGFGDSVVQYANSWVVVGAP------QKITAANQTGGLYQCGYSTGACEPI------GLQVPPE 86

  Fly   114 EYTFDSERKDFQWLGGSMDGGTKDTDKLLVCAPRFYAPSSRDNHLHGVCY--------------- 163
            .....        ||.|: ..|....:||.|.|..:....|:.:|.|:|:               
Human    87 AVNMS--------LGLSL-ASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSR 142

  Fly   164 ----------------------------------------------------------------- 163
                                                                             
Human   143 QECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFR 207

  Fly   164 ----------------------------------------------------------------- 163
                                                                             
Human   208 RSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDV 272

  Fly   164 -------------------------WVN-NTVASTP--QHVTRI---SPLRLKSEQVKEE----- 192
                                     |.. |.:||.|  :|:.::   ..|:....|:||:     
Human   273 IPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIE 337

  Fly   193 --DNGNKASFFYIMGELGLSAHVADDNTKFLIGAPGINTWRGSVILYRQVDPVDNPTASRRDTSK 255
              :..:.:||...|.:.|.||....|..  ::||.|..||.|...||   .|..:||        
Human   338 GTETTSSSSFELEMAQEGFSAVFTPDGP--VLGAVGSFTWSGGAFLY---PPNMSPT-------- 389

  Fly   256 ALRRTYRDVDSNDYTPEHYAPEIPTPGLWGQEEDSYFGYAVSSGFFDSSNPTKLLYVATAPQANK 320
            .:..:..:||.                     .|||.||:.....:.....    .|..||: .:
Human   390 FINMSQENVDM---------------------RDSYLGYSTELALWKGVQS----LVLGAPR-YQ 428

  Fly   321 QSGEAYIFDVRGKSIHKYHVFRGEQFGEYFGYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAI 385
            .:|:|.||....:.........|.|.|.|||.|:.:.|::.||.||:::....|..|.:......
Human   429 HTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVS 493

  Fly   386 YVFINKGFFNF--ERQILRSPVETMARFGTALSRLGDINHDGYNDVAVGAP--FAGNGTVFIYLG 446
            ...:.:|:..:  :..:.........|||.||:.|||:|.|...||.:|||  ....|.|:::.|
Human   494 VCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHG 558

  Fly   447 SEN-GLRDQPSQRLDAPSQQPSKYGSHMFGHGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPV 510
            ... .:....|||: |.||..|:.  ..||..||.|.|:..:|..|.|:||..  .|.|.|..||
Human   559 VLGPSISPSHSQRI-AGSQLSSRL--QYFGQALSGGQDLTQDGLVDLAVGARG--QVLLLRTRPV 618

  Fly   511 VKVHATVK----------SESRE-IKPEQEKVKITACYRLSTTSTDKLVQEQELAIRIAMDKQL- 563
            :.|..:::          .|.|| :..||..|:...|..:...|.: |:..::|...:.:|..| 
Human   619 LWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKN-LLGSRDLQSSVTLDLALD 682

  Fly   564 -----KRVKFTQTQTNEISFKVNANFGEQCRDFETQVRYSEKDIFTPIDLEMHYELTKK------ 617
                 .|..|.:|:...:|..........|.:|...:....:|..|||.|.:::.|..|      
Human   683 PGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFR 747

  Fly   618 ------VPDSEEFCETCAIVDPTEPKVSTQNIIFSTGCATD-VCTADLQLR-SKDVSPTYILGSA 674
                  ..|::.:              .|.::.|...|..| :|..:|.:. |.....:.::|| 
Human   748 NLRPMLAADAQRY--------------FTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGS- 797

  Fly   675 DTLRLNYEIT--NIGETAYLPQFNVTSTSRLAFAQVPGNCK---------VVDAVMV-------- 720
             .|.||.|:.  |.||.:|......:..:.|::..|....|         ..|:..|        
Human   798 -NLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWST 861

  Fly   721 -CDLN----RGRPLAKGDTDSVTISFDVS--QLSGQSLIIHAEVFSTGYEQN-PTDNRQTNVIGL 777
             |.:|    ||     |...:...:||||  .:.|..|::.|.|.|   |.| |..::.|..:.|
Human   862 SCRINHLIFRG-----GAQITFLATFDVSPKAVLGDRLLLTANVSS---ENNTPRTSKTTFQLEL 918

  Fly   778 -------------KEFTEIDASGGQTNSQIDLEHYSNSAE-----IVNNYEIKSNGPSVIEQLTV 824
                         ::||:             ..::|.|.|     .::.|::.:.|...: .:::
Human   919 PVKYAVYTVVSSHEQFTK-------------YLNFSESEEKESHVAMHRYQVNNLGQRDL-PVSI 969

  Fly   825 SFYIPIAYKVAGSTAIIPIINVTSLKMQASYDSQLLSIDLYDQNNTMLVVDPVEVTTTLSGGLER 889
            :|::|:                 .|..:|.:    :.:::....|..|.....::....|..|  
Human   970 NFWVPV-----------------ELNQEAVW----MDVEVSHPQNPSLRCSSEKIAPPASDFL-- 1011

  Fly   890 TVITQNRQSYDIHTSGHVHQTMEVLDTSMVATASMSRKRRDLKALTANREQYARISNVKAHDLLS 954
                           .|: |...|||.|:   |...|.|.|:.:.:...|             |.
Human  1012 ---------------AHI-QKNPVLDCSI---AGCLRFRCDVPSFSVQEE-------------LD 1044

  Fly   955 DDFKGKLPVN--RTIVFNCRDPEMTICVRAEMRVHFRPEKSINLNMRYSVDLNEVNAILVDPWEY 1017
            ...||.|...  |.|                              ::..|.:..|..|..|...|
Human  1045 FTLKGNLSFGWVRQI------------------------------LQKKVSVVSVAEITFDTSVY 1079

  Fly  1018 FVILTDLKLQKKGDPTSTSFSINRRIEPNIISKHQETGLPIWIIIVSVIGGLLLLSAISYLLYKF 1082
            ..:           |...:|   .|.:...:.:..:...|..:|:.|.|||||||:.|:.:|||.
Human  1080 SQL-----------PGQEAF---MRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKV 1130

  Fly  1083 GFFNRTKKDELDRLVQQNPVEPE 1105
            |||.|..|:.::....|  :.||
Human  1131 GFFKRQYKEMMEEANGQ--IAPE 1151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
scbNP_523750.2 Int_alpha 51..103 CDD:214549 16/53 (30%)
FG-GAP 350..388 CDD:280083 10/38 (26%)
Int_alpha 409..459 CDD:214549 21/53 (40%)
Int_alpha 473..>515 CDD:214549 17/42 (40%)
Integrin_alpha2 507..829 CDD:285619 78/398 (20%)
ITGAXNP_001273304.1 FG-GAP 1. {ECO:0000255|PROSITE-ProRule:PRU00803} 23..78 16/50 (32%)
FG-GAP 2. {ECO:0000255|PROSITE-ProRule:PRU00803} 79..138 13/74 (18%)
vWA_integrins_alpha_subunit 150..325 CDD:238746 7/175 (4%)
FG-GAP 3. {ECO:0000255|PROSITE-ProRule:PRU00803} 340..391 18/64 (28%)
FG-GAP 4. {ECO:0000255|PROSITE-ProRule:PRU00803} 392..443 14/77 (18%)
FG-GAP 5. {ECO:0000255|PROSITE-ProRule:PRU00803} 444..504 15/60 (25%)
Int_alpha 454..504 CDD:214549 13/50 (26%)
FG-GAP 6. {ECO:0000255|PROSITE-ProRule:PRU00803} 507..565 18/58 (31%)
Int_alpha 517..>558 CDD:214549 17/41 (41%)
FG-GAP 7. {ECO:0000255|PROSITE-ProRule:PRU00803} 570..630 23/65 (35%)
Int_alpha 582..628 CDD:214549 17/48 (35%)
Integrin_alpha2 615..1032 CDD:285619 94/498 (19%)
Integrin_alpha 1129..1143 CDD:278771 6/14 (43%)
GFFKR motif 1131..1135 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C101493114
eggNOG 1 0.900 E1_KOG3637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.864 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.