DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: scb and pat-2

Sequence 1:NP_523750.2 Gene:scb FlyBaseID:FBgn0286785 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_498948.1 Gene:pat-2 WormBaseID:WBGene00003929 Length:1226 Species:Caenorhabditis elegans

Alignment Length:1316 Identity:311/1317 (24%)
Similarity:498/1317 (38%) Gaps:326/1317 (25%)


  Fly     8 FPH---IFLALLALISHIEAFNFMPRPSRVINSPKHLKFHINQTRSSYFGYTLVIRQTS-----I 64
            ||.   :.|.||.|::.:..||.         ..|::..|  ....:||||:|......     :
 Worm     6 FPRRIGLLLGLLGLLAGVATFNI---------DTKNVVVH--HMAGNYFGYSLDFYHEQKGMPVL 59

  Fly    65 IVGAPRAQSTLESQRTINETGAIYRCSLTNGVCSPYVLDS-RGNVDAPYSEYTFDSERKDFQWLG 128
            :||||.|:|...:...|...||:|.||:....|....:|. :||:......:....|.|..|:.|
 Worm    60 VVGAPEAESNNPNLAGIRRPGAVYACSVNRATCREVHVDKMKGNLKKLNGSHLVPIEEKSHQFFG 124

  Fly   129 GSMDGGTKDTDKLLVCAPRFYAPSSRDNHLH--GVCYWVNN------TVASTPQHVTRISPLRLK 185
            .::....|. ||::||||::....|:...:.  |.|::..|      ..:|..|...|....||.
 Worm   125 ATVRSNDKH-DKIVVCAPKYTYFYSKFEVIEPVGTCFYAENGFDNAEEFSSCKQEPARHGRHRLG 188

  Fly   186 SEQVKEEDNGNKASFFYIMGELGLSAHV--ADDNTKFLIGAPGINTWRGSVILYRQVDPVDNPTA 248
                              .|:.|.||.|  ..:..:..|||||:..|:|::......:..|.|  
 Worm   189 ------------------YGQCGFSAAVPGKKNQNRVFIGAPGVWYWQGAMFSQNIKNQTDRP-- 233

  Fly   249 SRRDTSKALRRTYRDVDSNDYTPEHYAPEIPTPGLWGQEEDSYFGYAVSSGFFDSSNPTKLLYVA 313
                             :.:|..:.|             :....||:.::|.||......:  ||
 Worm   234 -----------------NTEYGSKEY-------------DHDMMGYSTATGDFDGDGIDDI--VA 266

  Fly   314 TAPQANKQSGEAYIFDVRGKSIHKYHVFRGEQFGEYFGYSVLAEDLNGDGKTDVIVSAPQH---- 374
            ..|:.|...|:..::..:.|.:.........|.|:|.|.||...|:|.||:.|:|:..|.:    
 Worm   267 GVPRGNDLHGKLVLYTSKLKMMINLTDEVSTQHGQYCGGSVAVADVNKDGRDDIIMGCPFYTDYG 331

  Fly   375 ALEDS--------HDNGAIYVFINKGFFNFERQILRSPVETMARFGTALSRLGDINHDGYNDVAV 431
            :::|:        :|.|.:.|.:......|.:||.....:...|||.|::..||:|.||||||.|
 Worm   332 SVKDAKTQERKPQYDVGKVIVMLQTAPGVFGKQIAVVGDDQWGRFGHAVAAAGDLNLDGYNDVIV 396

  Fly   432 GAPFAG---NGTVFIYLGSENGLRDQPSQRLDAPSQQPSKYGSHMFGHGLSRGSDIDGNGFNDFA 493
            |||:||   .|.|::..||::|:|:.|:|:::..:.......|  ||..|:...|:||||..|.|
 Worm   397 GAPYAGKNKQGAVYVIHGSKDGVRELPTQKIEGANIGHGNIKS--FGFSLTGNEDVDGNGMPDIA 459

  Fly   494 IGA---PNAEAVYLYRAYPVVKVHATVKSESREIKPEQE------KVKITACYRLST-------- 541
            :||   .|| ||.|.:  |||.|....:.||..|..|.:      |:...||..::|        
 Worm   460 VGAWKSGNA-AVLLTK--PVVTVTGQTEPESALISVEDKNCDVDGKLGKQACKHINTCFKYEGKG 521

  Fly   542 -TSTDKLVQEQELAIRIAMDKQL--KRVKFTQTQT-NEISFKVNANFGEQCRD----FETQVRYS 598
             |..|     .|..:|..:|...  .|..|.|... ::.|.||..  |.:.||    .|.:||..
 Worm   522 DTPND-----LEFDLRFNLDDHSPEPRAYFLQKDVKSDRSIKVAQ--GSKTRDHPSSIEQRVRLE 579

  Fly   599 E----------------KDIFTPIDLEMHYELTKKVPDSEEFCETCAIVDPTEPKVSTQN-IIFS 646
            :                ||..:||...::|...:.........:....:|.|.| :|.|| |..:
 Worm   580 KGRQKCFRHRFFASSTMKDKLSPIHWSVNYTYVESKTGKLRGDKLEPAIDTTVP-LSFQNKINIA 643

  Fly   647 TGCA-TDVCTADLQLRSKDVSPTYILGSAD-TLRLNYEITNIGETAY-------LPQ----FNVT 698
            ..|. .|:|..||::.:......::||:.| |:.:|..:.|.||.:|       :||    ..:.
 Worm   644 NNCGKDDLCVPDLKVTAVADREKFLLGTQDNTMLINVTVQNGGEDSYETKLYFDVPQGFEYGGIE 708

  Fly   699 STSRLAFAQVPGNCKVVDA-------VMVCDLNRGRPLAKGDTDS----VTISFDVSQLSGQSLI 752
            |.........|......|.       ...|||  |.||......|    ||.|.|...|:  .:.
 Worm   709 SVGGDGSKSAPACSPTSDEPDSDGKWTFACDL--GNPLPANKVVSSVVRVTASSDKPPLA--PIS 769

  Fly   753 IHAEVFSTGYEQNPT--DNRQTNVIGLKEFTEIDASGGQTNSQIDLEHYSNS----------AEI 805
            |:|.|.|:..|:..|  ||:.|..|.:....::..:|.....|:|....:.:          ..:
 Worm   770 INAHVNSSNDEEAHTVADNKVTFTIPVDFKNQLSLNGRSNPEQVDFSMTNKTRVDAFDDNEIGPV 834

  Fly   806 VNN-YEIKSNGPSVIEQLTVSFYIPIAYKVAGSTAII---PIINVTSL-KMQASYDSQLLSIDLY 865
            |:: |:|.:.|||.::..|:..:.|......|....|   |::|..:. :.:......:..::|.
 Worm   835 VSHLYQISNRGPSEVDSATLDIFWPSFSTEGGHLLYIITEPVVNPPNKGRCRVKQLQNVNPLNLR 899

  Fly   866 DQNNTMLVVDPV-----------------EVTTTLSGGLERTVITQNRQSYDIHTSGHVH----- 908
            ..|..:....||                 :.|||.|    ::...|:.|....|.||.||     
 Worm   900 ITNEHVPTEPPVAKTPNEYSREEDDESYEDETTTQS----QSTRHQSTQHQTHHQSGPVHVYEKD 960

  Fly   909 ----------------------------------QTMEVLDTSMVATASMSRKRRDLKALTAN-- 937
                                              ...|..|......|...|.:|:.......  
 Worm   961 EEKIRQNTGNWQYVEDKKKKGDYEYIPDDQEYDGDDFEEEDDEDFDRAGSKRVKRNPTPKKKKKG 1025

  Fly   938 -------REQYARISNVKAHDLLSD------DFKGKLPVNRTIVFNCRDPEMTICVRAEMRVHFR 989
                   |...||.|:::....||.      |:||  |::|..|    |.....|...|..::  
 Worm  1026 GEHRGEPRSDKARFSDLREAVKLSKEAGGVVDYKG--PLSRASV----DCNSLRCTHIECDIY-- 1082

  Fly   990 PEKSINLNMRYSVDLNEVNAILVDPWE--YFVILTDLKLQKKGD--------PTSTSFSINRR-- 1042
                         ||.|...:||:.:.  |...|.|.| ...||        .|||.:::..:  
 Worm  1083 -------------DLKEDEFVLVEIFSRLYTNTLVDEK-NPGGDISSLALARVTSTKYNLPHKPT 1133

  Fly  1043 ------IEPNIISKHQETGLPIWIIIVSVIGGLLLLSAISYLLYKFGFFNR----TKKDEL--DR 1095
                  ...|.|:..:...||.|:.:::::.||.:|..:..||::.|||.|    |:..||  ||
 Worm  1134 LITAVSTNMNAIASEEGRDLPWWLYLLAILIGLAILILLILLLWRCGFFKRNRPPTEHAELRADR 1198

  Fly  1096 LVQQNPVEPEAENLNS 1111
                   :|.|:..:|
 Worm  1199 -------QPNAQYADS 1207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
scbNP_523750.2 Int_alpha 51..103 CDD:214549 18/57 (32%)
FG-GAP 350..388 CDD:280083 14/50 (28%)
Int_alpha 409..459 CDD:214549 27/53 (51%)
Int_alpha 473..>515 CDD:214549 21/45 (47%)
Integrin_alpha2 507..829 CDD:285619 92/398 (23%)
pat-2NP_498948.1 Int_alpha 39..98 CDD:214549 18/59 (31%)
Int_alpha 299..359 CDD:214549 16/60 (27%)
Int_alpha 372..427 CDD:214549 27/55 (49%)
Int_alpha 440..>462 CDD:214549 11/22 (50%)
Integrin_alpha2 473..920 CDD:285619 101/461 (22%)
Integrin_alpha 1178..1192 CDD:278771 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.