DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: scb and Itga5

Sequence 1:NP_523750.2 Gene:scb FlyBaseID:FBgn0286785 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_034707.5 Gene:Itga5 MGIID:96604 Length:1053 Species:Mus musculus

Alignment Length:1217 Identity:301/1218 (25%)
Similarity:458/1218 (38%) Gaps:353/1218 (29%)


  Fly    13 LALLALI----SHIEAFNFMPRPSRVINSPKHLKFHINQTRSSYFGYTLVIRQ-----TSIIVGA 68
            |.||.|:    ..:..||.......|::.|.          .|.||:::...:     .|::|||
Mouse    29 LPLLLLLWPPPLQVGGFNLDAEAPAVLSGPP----------GSLFGFSVEFYRPGRDGVSVLVGA 83

  Fly    69 PRAQSTLESQRTINETGAIYRCSL-TNGV-CSPYVLDSRGNVDAPYSEYTFDSER----KDFQWL 127
            |:|.:   ||..:.:.||:|.|.. |:.: |:....||:|:.....|.|:...|.    |..||.
Mouse    84 PKANT---SQPGVLQGGAVYVCPWGTSPIQCTTIQFDSKGSRILESSLYSAKGEEPVEYKSLQWF 145

  Fly   128 GGSMDGGTKDTDKLLVCAPRFYAPSSRD--NHLHGVCYWVNNTVASTPQHVTRI---SPLRLKSE 187
            |.::   ......:|.|||.:...:.:|  |...|.||      .|| ::.|||   :|.|    
Mouse   146 GATV---RAHGSSILACAPLYSWRTEKDPQNDPVGTCY------LST-ENFTRILEYAPCR---- 196

  Fly   188 QVKEEDNGNKASFFYIMGELGLSAHVADDNTKFLIGAPGINTWRGSVILYRQVDPVDNPTASRRD 252
                .|.|:.|...|..|  |.||...... :.::|.||...|:|.::           :|::..
Mouse   197 ----SDFGSAAGQGYCQG--GFSAEFTKTG-RVVLGGPGSYFWQGQIL-----------SATQEQ 243

  Fly   253 TSKALRRTYRDVDSNDYTPEHYAPEIPTPGLWGQ---------EEDSYFGYAVSSGFFDSSNPTK 308
            .|                 |.|.||.....:.||         .:|||.||:|:.|.|...:...
Mouse   244 IS-----------------ESYYPEYLINPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTED 291

  Fly   309 LLYVATAPQANKQSGEAYIFDVRGKSIHKYHVFRGEQFGEYFGYSVLAEDLNGDGKTDVIVSAPQ 373
              :||..|:.|...|  |:..:.|..||..:...|||...||||:|.|.|.||||..|::|.||.
Mouse   292 --FVAGVPKGNLTYG--YVTVLNGSDIHSLYNVSGEQMASYFGYAVAATDTNGDGLDDLLVGAPL 352

  Fly   374 HALEDSHDN-----GAIYVFINKGFFNFERQILRSPVETM--------ARFGTALSRLGDINHDG 425
             .:|.:.|.     |.:|:::       :|.....|..|:        :|||::|:.|||::.||
Mouse   353 -LMERTADGRPQEVGRVYIYL-------QRPAGIDPTPTLTLTGQDEFSRFGSSLTPLGDLDQDG 409

  Fly   426 YNDVAVGAPFAG---NGTVFIYLGSENGLRDQPSQRLD---APSQQPSKYGSHMFGHGLSRGSDI 484
            |||||:||||.|   .|.|||:.|...||..:|||.|.   |..:.|..:||.:.|     |.|:
Mouse   410 YNDVAIGAPFGGEAQQGVVFIFPGGPGGLSTKPSQVLQPLWAAGRTPDFFGSALRG-----GRDL 469

  Fly   485 DGNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESREIKPEQEKVKI----TACYRLS--TTS 543
            ||||:.|..:|:...:...:||..|::...|::........||:....:    .:|..||  ..:
Mouse   470 DGNGYPDLIVGSFGVDKALVYRGRPIISASASLTIFPSMFNPEERSCSLEGNPVSCINLSFCLNA 534

  Fly   544 TDKLV--------------QEQELAIRIAMDKQLKRVKFTQTQTNEISFKVNANFGEQCRDFETQ 594
            :.|.|              |:|:..:|.|:....|:...|||      ..:.....|.||:.:..
Mouse   535 SGKHVPNSIGFEVELQLDWQKQKGGVRRALFLTSKQATLTQT------LLIQNGAREDCREMKIY 593

  Fly   595 VRYSE--KDIFTPIDLEMHYELTKKVP-DSEEFCETCAIVDPTEPKVSTQNIIFSTGCATD-VCT 655
            :|...  :|..:||.:.:::.|..|.| ||............:..:...|.::   .|..| :|.
Mouse   594 LRNESEFRDKLSPIHIALNFSLDPKAPMDSHGLRPVLHYQSKSRIEDKAQILL---DCGEDNICV 655

  Fly   656 ADLQLRSKDVSPTYILGSADTLRLNYEITNIGE-TAYLPQFNVTSTSRLAFAQV---PGNCKVVD 716
            .||||..........||..:.|.|.:...|:|| .||..:..||:.....::.:   |||...:.
Mouse   656 PDLQLDVYGEKKHVYLGDKNALNLTFHAQNLGEGGAYEAELRVTAPLEAEYSGLVRHPGNFSSLS 720

  Fly   717 ----AV-----MVCDLNRGRPLAKG---------------DTDSVTISFDVSQLSGQSLIIHAEV 757
                ||     :||||  |.|:..|               ||.. ||.||...||          
Mouse   721 CDYFAVNQSRQLVCDL--GNPMKAGTSLWGGLRFTVPHLQDTKK-TIQFDFQILS---------- 772

  Fly   758 FSTGYEQNPTDNRQTNVIGLKEFTEIDASGGQTNSQIDLEHYSNSAEIV---------------- 806
                   ...:|.|:||:......|..|       |:.|...|....::                
Mouse   773 -------KNLNNSQSNVVSFPLSVEAQA-------QVSLNGVSKPEAVIFPVSDWNPQDQPQKEE 823

  Fly   807 -------NNYEIKSNGPSVIEQLTVSFYIPIAYKVAGSTAIIPIINVTSLKMQASYDSQLLSIDL 864
                   :.||:.:.|||.|.|..:....|.|.:   ...::.:..||.|....|.         
Mouse   824 DLGPAVHHVYELINQGPSSISQGVLELSCPQALE---GQQLLYVTKVTGLSNCTSN--------- 876

  Fly   865 YDQNNTMLVVDPVEVTTTLSGGLERTVITQNRQSYDIHTSGHVHQTMEVLDTSMVATASMSRKRR 929
            |..|:..|.:||                         .||.|..|..|....|..|:.       
Mouse   877 YTPNSQGLELDP-------------------------ETSPHHLQKREAPGRSSTASG------- 909

  Fly   930 DLKALTANREQYARISNVKAHDLLSDDFKGKLPVNRTIVFNCRDPEMTICVRAEMRVHFRP---- 990
                                                |.|..|  ||.. |.|  :|..|.|    
Mouse   910 ------------------------------------TQVLKC--PEAK-CFR--LRCEFGPLHRQ 933

  Fly   991 -EKSINLNMR-------------YSVDLNEVNAILVDPWEYFVILTDLKLQKKGDPTSTSFSINR 1041
             .:|:.|:.|             :|:....|...|..|  |.::...|..:|....|:..::   
Mouse   934 ESRSLQLHFRVWAKTFLQREYQPFSLQCEAVYEALKMP--YQILPRQLPQKKLQVATAVQWT--- 993

  Fly  1042 RIEPNIISKHQETGLPIWIIIVSVIGGLLLLSAISYLLYKFGFFNRT 1088
                   ......|:|:||||::::.|||||..:.|:|||.|||.|:
Mouse   994 -------KAEGSNGVPLWIIILAILFGLLLLGLLIYVLYKLGFFKRS 1033

Known Domains:


GeneSequenceDomainRegion External IDIdentity
scbNP_523750.2 Int_alpha 51..103 CDD:214549 17/59 (29%)
FG-GAP 350..388 CDD:280083 18/43 (42%)
Int_alpha 409..459 CDD:214549 29/53 (55%)
Int_alpha 473..>515 CDD:214549 12/42 (29%)
Integrin_alpha2 507..829 CDD:285619 84/397 (21%)
Itga5NP_034707.5 FG-GAP 1. {ECO:0000255|PROSITE-ProRule:PRU00803} 46..111 19/78 (24%)
Int_alpha 59..117 CDD:214549 17/71 (24%)
FG-GAP 2. {ECO:0000255|PROSITE-ProRule:PRU00803} 131..191 19/70 (27%)
FG-GAP 3. {ECO:0000255|PROSITE-ProRule:PRU00803} 196..248 17/91 (19%)
FG-GAP 4. {ECO:0000255|PROSITE-ProRule:PRU00803} 262..314 15/56 (27%)
Int_alpha 271..>313 CDD:214549 15/46 (33%)
FG-GAP 5. {ECO:0000255|PROSITE-ProRule:PRU00803} 315..380 24/73 (33%)
Int_alpha 325..382 CDD:214549 21/65 (32%)
FG-GAP 6. {ECO:0000255|PROSITE-ProRule:PRU00803} 381..440 27/59 (46%)
Int_alpha 392..446 CDD:214549 29/54 (54%)
FG-GAP 7. {ECO:0000255|PROSITE-ProRule:PRU00803} 444..507 19/68 (28%)
Int_alpha 458..510 CDD:214549 15/57 (26%)
Integrin_alpha2 493..925 CDD:285619 110/553 (20%)
GFFKR motif 1024..1028 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C101743367
eggNOG 1 0.900 E1_KOG3637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.