DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and SQS1

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_014175.1 Gene:SQS1 SGDID:S000005168 Length:767 Species:Saccharomyces cerevisiae

Alignment Length:807 Identity:137/808 (17%)
Similarity:233/808 (29%) Gaps:336/808 (42%)


  Fly     2 SLPAEEEDLADTVAKYDS----IELKSIQDL---ETCEQQQLLQYVEKLHGII--RKYDTKL--- 54
            |:|..|.||.|..|.::.    |..|:|:|.   ...:.:.:     |:.|:.  .:||:..   
Yeast    51 SIPLGEGDLDDVGADFNPGRAFISPKTIEDYYFGRDAKSRSM-----KMGGLRPGNRYDSSTDLQ 110

  Fly    55 ---ASYKQKLLHYVSREE--------------KVSCDKASQATESE----------LQECQYSME 92
               |:::::.:.:|..:|              |.....:.:..|.|          ..:.:|...
Yeast   111 AGRAAFRKRPMQFVKAKEVYDPSHNMIQKLRAKNETKNSEEIVEREADVFEEPGKMTSDVEYINN 175

  Fly    93 NDEDTNKKDQPNDLSATDAFS------------FVDEMRQAAKHAENLNNFVYEH---------- 135
            .|.:....|..|..|...:.|            ||||..|.:.....:.....|.          
Yeast   176 EDSENEDDDSQNSPSTDHSLSSNESKVEDGDLFFVDEEAQQSPDLTKIKRVCIEEIARPREVAIE 240

  Fly   136 -----TSGMY------------------------YDPKTGYYYNAEYGLYYDGNNGCYYSYD--- 168
                 |.|..                        |.|..||..|..:|::...::.....|:   
Yeast   241 FDPILTIGKVELSVSEGNESKEISVDVPNKGNKTYHPFAGYISNVLHGMHTSDSDNDELDYEIET 305

  Fly   169 --HAKDSYEFHSQAQV------------------------------------------QANDAAK 189
              :::..||..:.::|                                          :.|:...
Yeast   306 ENNSEPLYESSASSEVDQGFNYVGQRHNSRADNNLLPSPSPQLTEDIKCLSINGTKTFEGNNDNL 370

  Fly   190 PESEDEDLEVQFDE----------------LGGV------------------------ITD---- 210
            |....|:||..|.|                :|||                        :||    
Yeast   371 PSPASEELEFGFKEEDFVINTNDIVVSNIRMGGVDNSYYLRCYRLLGDYDFHWIDQDLLTDFVVD 435

  Fly   211 -----------------HETLKKIKAEK--------QKAKDQAEKSKRKAKKKK----------- 239
                             :..:.||:..:        ..:.|:.:..:..:.:..           
Yeast   436 ELGLPEDRLPAYLNFIKNSLIPKIEPAEPTYSDIPISDSSDEGDSYEGDSYEDDEDMASSVVHSD 500

  Fly   240 -----------SKKHSKKRSKK------ERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSS 287
                       :.||..:|.|.      |.:.|.||:....||..:.|.|..|..||..|....:
Yeast   501 IEEGLDDLIAYTLKHDTERFKTFETKSLETKGKGKKKKLLIDDALALDTETLETLQSKFSKRIET 565

  Fly   288 NEDSSSNTEDSSVPVFKAAGRFQDIAKKYPPSLRIIVQETNVESLKVGSLHLITYKGGSLGREGA 352
            ........||.   :.:......|:.||||..|.|                              
Yeast   566 KAKKRKAKEDF---IDQENRNSNDMLKKYPYGLHI------------------------------ 597

  Fly   353 HDVIIPDVNVSKCHLKFKYENKLGIYQCLDLGSRNGTILNGSPMSSDAMDLVHGSVITLGQTRLL 417
                        .::|.::|:.|         |||...|...|:..      ||:...:   ::.
Yeast   598 ------------QNIKDEFESFL---------SRNNDRLTFPPLDP------HGNKTVM---KIA 632

  Fly   418 CHVHEGNSTCGLCEPGLLIENSPPVVAAVASSTASVLSHKEQLKKLQRKYGLENEKFVDTSGNGQ 482
            .|.:..:|..|                 .|:.|:.|:   |::||  .|:...|...:|.....:
Yeast   633 KHYNMKSSKIG-----------------KANHTSVVV---EKIKK--TKWSSPNYSLIDQLMRQR 675

  Fly   483 SNY---------NDRAATRRVQV--GSSTDKEKTEVACVNTEIGSSNKGFKMLSKLGWQKGEKLG 536
            ..:         .::||..|.:.  |....||...|.....|||:.|.|.:||.||||:.||.||
Yeast   676 PVFMRIDIRRPREEQAAFERTKTIRGKFHVKEGEIVGQNAPEIGNENIGRRMLEKLGWKSGEGLG 740

  Fly   537 KTNASAGLLEPINVVANEGTSGLGNSD 563
             ...:.|:.|||.....:..|||.:|:
Yeast   741 -IQGNKGISEPIFAKIKKNRSGLRHSE 766

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 12/97 (12%)
OCRE repeat 1 129..136 CDD:293883 1/22 (5%)
OCRE repeat 2 137..144 CDD:293883 3/31 (10%)
OCRE repeat 3 145..152 CDD:293883 3/7 (43%)
OCRE repeat 4 153..159 CDD:293883 1/6 (17%)
OCRE repeat 5 162..169 CDD:293883 1/12 (8%)
FHA 346..411 CDD:278899 10/65 (15%)
G-patch 516..560 CDD:279867 19/44 (43%)
SQS1NP_014175.1 R3H_G-patch 597..654 CDD:100075 18/137 (13%)
G-patch 721..765 CDD:307632 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4438
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.