DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and Rbm5

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001346454.1 Gene:Rbm5 / 83486 MGIID:1933204 Length:815 Species:Mus musculus


Alignment Length:602 Identity:119/602 - (19%)
Similarity:189/602 - (31%) Gaps:216/602 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TKLASYKQKLLHYVSR-----EEKVSCDKASQATESELQECQYSMENDEDTN-------KKDQPN 104
            |:...|.|....:..:     |...|....:..|.:.......|.:....|:       ::.||:
Mouse   369 TQYTQYSQDYQQFYQQQAGGLESDTSATSGTTVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPS 433

  Fly   105 DLSATDAFSFVDEMRQAA---------KHA-ENLNNFVYEHTSGMYYDPKTGYYYNAEYGLYYDG 159
            ..::|.|        .||         |:| .:.:.:.|:.:||.||||.||.||:.....||:.
Mouse   434 TSTSTQA--------PAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNS 490

  Fly   160 NNGCYYSYDHAKDSYEFHSQAQVQANDAAKPESEDEDLEVQFDELGGVITDHETLKKIKAEKQKA 224
            ....|..:|..|::|.  ..|:..:|......|..|..|            .:...|.|..:|.|
Mouse   491 LTQQYLYWDGEKETYV--PAAEASSNQQTGLPSTKEGKE------------KKEKPKSKTAQQIA 541

  Fly   225 KDQAEKSKRKAKKKKSKKHS--------------------------KKRSKKERRHKSKKRHRHS 263
            ||....:|...|:|::.|:|                          ||.:..||:....:..|:.
Mouse   542 KDMERWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLLPELVRNG 606

  Fly   264 DDERSNDAEEGELSQSSDSSSDSSNEDSSSNTEDSSVPVFKAAGRFQDIAKKYPPSLRIIVQETN 328
            |:|  |..:.|.::.   .|.||.||                                    |..
Mouse   607 DEE--NPLKRGLVAA---YSGDSDNE------------------------------------EEL 630

  Fly   329 VESLKVGSLHLITYKGGSLGREGAHDVIIPDVNVSKCHLKFKYENKLGIYQCL-DLGSRNGTILN 392
            ||.|:.....|..:|               .:....|..:|...:.|..:|.| ||..:|..|..
Mouse   631 VERLESEEEKLADWK---------------KMACLLCRRQFPNRDALVRHQQLSDLHKQNMDIYR 680

  Fly   393 GSPMSSDAMDLVHGSVITLGQTRLLCHVHEGNSTCGLCEPGLLIENSPPVVAAVASSTASVLSHK 457
            .|.:|...::.:                                                     
Mouse   681 RSRLSEQELEAL----------------------------------------------------- 692

  Fly   458 EQLKKLQRKYGLENEKFVDTSGNGQSNYNDRAATRRVQVG-----SSTDKEKTEVACVNTE---- 513
             :|::.:.|                  |.||||.||.:.|     ....|::.:...||.|    
Mouse   693 -ELREREMK------------------YRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPTK 738

  Fly   514 --IGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPINVVANEGTSGLGNSDPVLSSSRTIDKRK 576
              |..||.|.|||..:||::|..||:  ...|:..||........:|||........|.. |..|
Mouse   739 DGIDHSNIGNKMLQAMGWREGSGLGR--KCQGITAPIEAQVRLKGAGLGAKGSAYGLSGA-DSYK 800

  Fly   577 LANLKITQARYQRASDM 593
            .|   :.:|.:.|.::|
Mouse   801 DA---VRKAMFARFTEM 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 18/53 (34%)
OCRE repeat 1 129..136 CDD:293883 1/6 (17%)
OCRE repeat 2 137..144 CDD:293883 5/6 (83%)
OCRE repeat 3 145..152 CDD:293883 4/6 (67%)
OCRE repeat 4 153..159 CDD:293883 2/5 (40%)
OCRE repeat 5 162..169 CDD:293883 1/6 (17%)
FHA 346..411 CDD:278899 11/65 (17%)
G-patch 516..560 CDD:279867 15/43 (35%)
Rbm5NP_001346454.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93
RRM1_RBM5 93..179 CDD:241196
zf-RanBP 183..210 CDD:366216
RanBP2-type Zn finger 185..204 CDD:275375
RRM2_RBM5 229..314 CDD:241199
Required for interaction with U2AF2. /evidence=ECO:0000250 321..809 117/595 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..468 14/90 (16%)
Sufficient for interaction with ACIN1, PRPF8, SFRS3, SNRPB, SNRPN, SNRNP70 and SNRNP200. /evidence=ECO:0000250 452..535 25/96 (26%)
OCRE_RBM5 455..510 CDD:293887 18/56 (32%)
OCRE repeat 1 460..467 CDD:293887 1/6 (17%)
OCRE repeat 2 468..475 CDD:293887 5/6 (83%)
OCRE repeat 3 476..483 CDD:293887 4/6 (67%)
OCRE repeat 4 484..491 CDD:293887 2/6 (33%)
OCRE repeat 5 493..500 CDD:293887 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..539 7/42 (17%)
G-patch 743..785 CDD:366717 15/43 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.