DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and Gpatch2

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_080643.4 Gene:Gpatch2 MGIID:1915019 Length:527 Species:Mus musculus

Alignment Length:542 Identity:114/543 (21%)
Similarity:177/543 (33%) Gaps:159/543 (29%)


  Fly    77 SQATESELQECQYSMENDEDTNKKDQPNDLSATDAFSFVDEMRQAAKH-AENLNNFVYEHTSGMY 140
            |:.::|.|:|...........||||:    |.:|     |:|..|.:. :.||::.|        
Mouse    88 SEGSDSSLEEPSKDYREKHSNNKKDR----SDSD-----DQMLVAKRRPSSNLSSSV-------- 135

  Fly   141 YDPKTGYYYNAEYGLYYDGNNGCYYSYDHAKDSYEFHS---------------------QAQVQA 184
                             .|....::..|.|.||....:                     :...|.
Mouse   136 -----------------RGKRLLWHESDFAVDSLGNRTLRRRRKVKRMAVDLPQDVSSKRTMTQL 183

  Fly   185 NDAAKPESEDEDLEVQFDELGGVITDHETLKKIKAEKQKAKDQAEKSKRKAKKKKSKKHSKKRSK 249
            .:..:.:..|.|...|:.|.        |.||:|..|.|......|::.:....:|         
Mouse   184 PEGCRDQDMDNDRASQYPEF--------TRKKVKKRKLKGIRPGPKTQEEGGVLES--------- 231

  Fly   250 KERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSSNE------DSSSNTEDSSVPVF--KAA 306
            :||...:|.|..:.:.:.|:     ||...||:||.||.:      |.....:|.....|  |.:
Mouse   232 EERSQPNKDRMEYEEQKASD-----ELRSESDTSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKES 291

  Fly   307 GRFQDIA-------KKYPPSLRIIVQETNVESLKVGSLHLITY--KGGSLGR-EGAHDVIIPDVN 361
            |....||       |..|..|...:.:...||:..||..|:::  :||...| ...|..  |..|
Mouse   292 GGACGIAGVVPWWEKDEPAELDTNLPDPVFESILSGSFPLMSHPGRGGFQARLSRLHGT--PSKN 354

  Fly   362 VSKCHLKFKYENKLGIYQCLDLGSRNGTILNGSPMSSDAMDLVHGSVITLGQTRLLCHVHEGNST 426
            :.|                 ..|:....:....|.|:..|  ||.|..        .|.|:    
Mouse   355 IKK-----------------SSGAPPSMLSAPGPGSNKRM--VHFSPD--------AHRHD---- 388

  Fly   427 CGLCEPGLLIENSPPVVAAVASSTASVLSHKE--QLKKLQRKYGLENEKFVDTSGNGQSNYNDRA 489
             ....||...|:..   ..:.....:...||:  .||...|:..:.    :.:...|......:|
Mouse   389 -HWFSPGARTEHGQ---HQLLRDNRAERGHKKSCSLKTASRQTSMH----LGSLCTGDIKRRRKA 445

  Fly   490 A-----TRRVQVGSSTDKEKTEVACVNTEIGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPIN 549
            |     |....||.:..           .|..||.|.:||..:||..|..||:.  ..|:.||:.
Mouse   446 APLPGPTAAGIVGENAQ-----------PILESNIGNRMLQSMGWTPGSGLGRD--GRGIAEPVQ 497

  Fly   550 VVANEGTSGLGNSDPVLSSSRT 571
            .|  :...|||...|:..||.|
Mouse   498 AV--QRPKGLGLGFPLPKSSPT 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 8/54 (15%)
OCRE repeat 1 129..136 CDD:293883 1/7 (14%)
OCRE repeat 2 137..144 CDD:293883 0/7 (0%)
OCRE repeat 3 145..152 CDD:293883 0/7 (0%)
OCRE repeat 4 153..159 CDD:293883 0/6 (0%)
OCRE repeat 5 162..169 CDD:293883 1/7 (14%)
FHA 346..411 CDD:278899 12/66 (18%)
G-patch 516..560 CDD:279867 16/44 (36%)
Gpatch2NP_080643.4 G-patch 467..510 CDD:279867 17/47 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4438
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.