DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and SON

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_620305.2 Gene:SON HGNCID:11183 Length:2426 Species:Homo sapiens

Alignment Length:304 Identity:64/305 (21%)
Similarity:117/305 (38%) Gaps:70/305 (23%)


  Fly   183 QANDAAKPESE--DEDLEVQFDELGGVITDHETLKK--IKAEKQKAK------DQAEKSKRKAKK 237
            ||.|||.....  :|::..:.:|:...:.|.|...|  :|...:|::      |..::...| |.
Human    45 QAGDAAASARSLPNEEIVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTK-KS 108

  Fly   238 KKSKKH-SKKRSKKERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSSNEDSS--------- 292
            ||.||| :||:.||:.:.|..||.....:.::...::|.:...|||.....:|.|:         
Human   109 KKHKKHKNKKKKKKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRA 173

  Fly   293 ---SNTEDSSVPVFKAAGRFQDIAKKYPPSLRIIVQETNV-ESLK--VGSLHLITYKGGSLGREG 351
               |.|.:|...|.:            ||.:.:.|.|.:: |:||  ..:..|.......:..:.
Human   174 FGPSETNESPAVVLE------------PPVVSMEVSEPHILETLKPATKTAELSVVSTSVISEQS 226

  Fly   352 AHDV-IIPDVNVSKCHLKFKYENKLGIYQCLDLGSRNGTILNGSPMSSDAMDLVHGS-VITLG-- 412
            ...| ::|:.:::|....|.                      .:|:.:..:.|.... |:|:.  
Human   227 EQSVAVMPEPSMTKILDSFA----------------------AAPVPTTTLVLKSSEPVVTMSVE 269

  Fly   413 -QTRLLCHVHEGNSTCGLCEPGLLIENSPPVVAAVASSTASVLS 455
             |.:.:....|..|.    ||..::...|||...:..|...|:|
Human   270 YQMKSVLKSVESTSP----EPSKIMLVEPPVAKVLEPSETLVVS 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883
OCRE repeat 1 129..136 CDD:293883
OCRE repeat 2 137..144 CDD:293883
OCRE repeat 3 145..152 CDD:293883
OCRE repeat 4 153..159 CDD:293883
OCRE repeat 5 162..169 CDD:293883
FHA 346..411 CDD:278899 8/67 (12%)
G-patch 516..560 CDD:279867
SONNP_620305.2 Patatin_and_cPLA2 <359..457 CDD:299702
17 X 10 AA tandem repeats of L-A-[ST]-[NSG]-[TS]-MDSQM 726..895
11 X 7 AA tandem repeats of [DR]-P-Y-R-[LI][AG][QHP] 912..988
14 X 6 AA repeats of [ED]-R-S-M-M-S 1006..1126
Forkhead_N 1016..1129 CDD:254796
3 X 11 AA tandem repats of P-P-L-P-P-E-E-P-P-[TME]-[MTG] 1147..1179
4 X 8 AA tandem repeats of V-L-E-SS-[AVT]-VT 1359..1390
7 X 7 AA repeats of P-S-R-R-S-R-[TS] 1925..1994
2 X 19 AA repeats of P-S-R-R-R-R-S-R-S-V-V-R-R-R-S-F-S-I-S 1934..2013
3 X tandem repeats of [ST]-P-[VLI]-R-[RL]-[RK]-[RF]-S-R 2013..2039
G-patch 2305..2348 CDD:279867
DSRM 2371..>2408 CDD:238007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4438
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.