DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and LOC567058

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_005166176.1 Gene:LOC567058 ID: Length:1393 Species:Danio rerio

Alignment Length:514 Identity:117/515 (23%)
Similarity:182/515 (35%) Gaps:137/515 (27%)


  Fly    76 ASQATESELQECQYSMENDEDTNKKDQP--NDLSATDAFSFVDEMRQAAKHAENLNNFVYEHTSG 138
            :|..|:..:...:.::.....|.::..|  :|.:.:.|...:|.....:: |.:|:.|:|:.|||
Zfish   967 SSSLTQGVMYSNKSAIAQTVQTAEQQAPALSDAAVSGAADSIDGYNYGSE-APDLSAFLYDATSG 1030

  Fly   139 MYYDPKTGYYYNAEYGLYYDGNNGCYYSYDHAKDSYEFHSQAQVQANDAAK-PESEDEDLEVQFD 202
            .||||:|..||:.....:||..|..|..:|.:..:|   ...|..:.|... ||....::.....
Zfish  1031 FYYDPQTTLYYDPNSRYFYDAQNQQYLYWDSSLKTY---IPVQSSSTDGQNVPEVPAPEVPAPVT 1092

  Fly   203 ELGGVITDHETLKKIKAEKQKAKDQA-------EKSKRKAKKKKSKKHSKKRSKKERRHKSKKRH 260
            .:..||.     ..||.|:.||..:|       |:..::.:|::.:|..|.||.  ...|..|  
Zfish  1093 PVAEVIA-----VPIKEEEAKAVSEALPEVRVEEEPGQRGEKREKEKEEKPRSL--AAFKIMK-- 1148

  Fly   261 RHSDDERSNDAEEGELSQSSDSSS--------DSSNEDSSSNTEDSSVPVFKAAGRFQDIAKK-- 315
                     |.|.....|:|...|        .|.::...|...|::..:|:......::.||  
Zfish  1149 ---------DMERWAKIQNSKKESVRAPSPVLKSGDDHRPSKAADAAFAIFERKTGADELFKKPL 1204

  Fly   316 YPPSLRIIVQETNVESLK--VGSLHLIT--YKGGS-LGREGAHDVIIPDVNVSKCHLKFKYENKL 375
            .||      ::.:.:|.|  :|||.::.  |..|| ...|..||               |.|   
Zfish  1205 APP------KQKDEKSSKRPMGSLGMLAADYGAGSDEEEEEKHD---------------KQE--- 1245

  Fly   376 GIYQCLDLGSRNGTILNGSPMSSDAMDLVHGSVITLGQTRLLCHVHEGNSTCGLCEPGLLIENSP 440
                    .||..   ...|.:.:..|            ||   .......|.||.     ...|
Zfish  1246 --------ASRPA---KSQPQADEKED------------RL---TDWKKMACLLCR-----RQFP 1279

  Fly   441 PVVAAVASSTASVLSHKEQLK---KLQRK----YGLEN-EKFVDTSGNGQSNYNDRAATRRVQVG 497
            ...|.:.....|.| ||:.::   |::|.    ..||| ||.:.|...|.|....|...:....|
Zfish  1280 NKDALIRHQQLSDL-HKQNMEIHLKIKRSKRELEALENQEKEMKTKAPGSSPEAKRRKPQNTWAG 1343

  Fly   498 SSTDKEKTEVACVNTEIGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPINVVANEGT 556
            ||.|..|          ||...|      ||.:..|:..|        ||  ||.|..|
Zfish  1344 SSRDSFK----------GSERPG------LGLETTERKKK--------EP--VVWNHAT 1376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 20/53 (38%)
OCRE repeat 1 129..136 CDD:293883 2/7 (29%)
OCRE repeat 2 137..144 CDD:293883 6/7 (86%)
OCRE repeat 3 145..152 CDD:293883 3/7 (43%)
OCRE repeat 4 153..159 CDD:293883 2/6 (33%)
OCRE repeat 5 162..169 CDD:293883 2/7 (29%)
FHA 346..411 CDD:278899 10/66 (15%)
G-patch 516..560 CDD:279867 12/42 (29%)
LOC567058XP_005166176.1 RRM_SF 633..710 CDD:302621
RRM_SF 815..899 CDD:302621
OCRE_RBM5_like 1017..1070 CDD:293881 20/56 (36%)
OCRE repeat 1 1021..1028 CDD:293881 2/7 (29%)
OCRE repeat 2 1029..1036 CDD:293881 6/7 (86%)
OCRE repeat 3 1037..1044 CDD:293881 3/7 (43%)
OCRE repeat 4 1045..1052 CDD:293881 2/7 (29%)
OCRE repeat 5 1054..1061 CDD:293881 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.