DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and aggf1

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_021324539.1 Gene:aggf1 ZFINID:ZDB-GENE-060929-836 Length:782 Species:Danio rerio

Alignment Length:762 Identity:213/763 (28%)
Similarity:338/763 (44%) Gaps:182/763 (24%)


  Fly     1 MSLPAEEEDLADTVAKYDSIELKSI----------QDLETCE------QQQLLQYVEKLHGIIRK 49
            :|:.||.:  ||..|..|.:|.:.:          ::|:||:      |:||.| .|:|......
Zfish    22 LSMAAEGK--ADLEAGDDGLESEIVSLRTQAEALREELKTCKDELQKLQKQLSQ-SERLQKTTES 83

  Fly    50 YDTKLASYKQKL---LHYVSREEKVSCDKASQATESELQECQY-------------------SME 92
            |:..|.....||   :|...:.:|...|..:|..|....|..|                   :.|
Zfish    84 YNEDLRQQVDKLSAEIHERKKRDKEKVDAETQTEEYTWTETDYYNYYYGGYYQSETTAEQETTAE 148

  Fly    93 NDEDTNKK-----------------------DQPNDLS--------ATDAFSFVDEMRQAAKHAE 126
            ..|:..|:                       :|||:.|        :.:|.|..|.:|..|:.|.
Zfish   149 TQENVVKETQEASVYVEEQHPRIAETSVANPEQPNETSDIPQTEEASGEAGSIADMLRATAEEAM 213

  Fly   127 NLNNFVYEHTSGMYYDPKTGYYYNAEYGLYYDGNNGCYYSYDHAKDSYEFHSQAQVQANDAAKPE 191
            |..|||::.:||||||..||:||::...||||.|.|.||.||.....|:|||:.:|.|  |..||
Zfish   214 NQTNFVFDESSGMYYDHSTGFYYDSSSQLYYDANTGMYYYYDPESGKYQFHSRIEVPA--ALHPE 276

  Fly   192 -----------------------------SEDEDLEVQFDELGGVITDHETLKKIKAEK-QKAKD 226
                                         .|::::.::.|:|.   .:|...||..|.. :|.:.
Zfish   277 VEQTPQRKTKDRKNRKSVKNTERASCPDGGENKEVVLEIDKLS---ENHHRGKKDDAGSFKKGRK 338

  Fly   227 QAEKSKRKAKKKKSKKHSKKRSKKERRHKSKKRHRHSDDER------------------------ 267
            ...:|.:::::.||:..|:|||  ..|.|:::|...|||.|                        
Zfish   339 SRSRSPQRSRRTKSRDRSRKRS--TNRKKTRRRSEDSDDSRCSRRKENGSNSEDKRKKKTKKKRA 401

  Fly   268 -------------SNDAEEGELSQSS----DSSSDSSNEDSSSNTEDSSVPVFKAAGRFQDIAKK 315
                         .::.||||:::|.    ..|..||:..|...|.||.....:...:.|:.|  
Zfish   402 LRDRKSGSDEGSSESEPEEGEITESDGENHSCSVSSSSASSVQKTLDSPDEEMEMETQMQEEA-- 464

  Fly   316 YPPSLRIIVQETNVESLKVGSLHLITYKG-GSLGREG--AHDVIIPDVNVSKCHLKFKYENKLGI 377
            :||.:|:.|..:.|  |:.|:|.::|... .::|||.  .|.:.||::.|||.|.:..::.....
Zfish   465 WPPCVRVTVVRSPV--LQTGTLFILTADTVATIGREKDMNHAIRIPEMGVSKSHAEVYFDQDQQC 527

  Fly   378 YQCLDLGSRNGTILNGS-----PMSSDAMDLVHGSVITLGQTRLLCHVHEGNSTCGLCEPGLLI- 436
            |..:|.||:|||:|||:     .:..|...|.||..:.:|:|.|..|:|.|.:||..||||.:| 
Zfish   528 YMLIDQGSQNGTVLNGNRILQPKVRCDPCPLTHGDELKMGETVLSFHIHAGTATCDGCEPGQIIA 592

  Fly   437 --------ENS---PPVVAAVASSTASVLSHKEQLKKLQRKYGLENEKFVDTSGNGQSNYNDRAA 490
                    |:|   .....||.|........:::||.::.||||::..:.:......|.|.|||.
Zfish   593 HLSRHKKDESSVGQAHCARAVLSKEDKEAQRQKELKMMKVKYGLKSSDYEEQKPLKNSKYKDRAE 657

  Fly   491 TRRVQVGSSTDKEKTEV-ACVNTEIGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPINVVANE 554
            .||..|||....::.:. |.|:.|||..|||.:||.|:||::||.|||.  .||:.:||.:...:
Zfish   658 NRRQTVGSEGKFQRDDAPASVHVEIGDENKGRQMLEKMGWKRGEGLGKD--GAGMKDPIQLHMRK 720

  Fly   555 GTSGLGNSDPVLSSSRTIDKRKLANLKITQARYQRASDMFGQSDDSD 601
            ..||||:|    .|:.:::...|...| ||..::||.:.|.::..:|
Zfish   721 AQSGLGSS----GSAMSVEDASLTKSK-TQRNWERARERFSEACHTD 762

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 27/53 (51%)
OCRE repeat 1 129..136 CDD:293883 3/7 (43%)
OCRE repeat 2 137..144 CDD:293883 6/7 (86%)
OCRE repeat 3 145..152 CDD:293883 4/7 (57%)
OCRE repeat 4 153..159 CDD:293883 4/6 (67%)
OCRE repeat 5 162..169 CDD:293883 5/7 (71%)
FHA 346..411 CDD:278899 24/72 (33%)
G-patch 516..560 CDD:279867 20/44 (45%)
aggf1XP_021324539.1 HSP70 <13..149 CDD:331774 29/130 (22%)
OCRE_VG5Q 211..264 CDD:293883 27/53 (51%)
OCRE repeat 1 216..223 CDD:293883 3/7 (43%)
OCRE repeat 2 224..231 CDD:293883 6/7 (86%)
OCRE repeat 3 232..239 CDD:293883 4/7 (57%)
OCRE repeat 4 240..246 CDD:293883 4/6 (67%)
OCRE repeat 5 249..256 CDD:293883 5/7 (71%)
FHA 470..575 CDD:238017 35/107 (33%)
G-patch 685..726 CDD:307632 20/43 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332301332
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H135679
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D334272at33208
OrthoFinder 1 1.000 FOG0005676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133089
Panther 1 1.100 LDO PTHR23106
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.