DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and AGGF1

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_060516.2 Gene:AGGF1 HGNCID:24684 Length:714 Species:Homo sapiens

Alignment Length:705 Identity:195/706 (28%)
Similarity:315/706 (45%) Gaps:133/706 (19%)


  Fly     7 EEDLADTVAKYDSIELKSIQDLETCEQQ-----QLLQYVEKLHGIIRKYDTKLASYKQKLLHYVS 66
            |.:||....|.:.:|    ::|.:|::|     :||.:.|:|:......:.:|.:..::|...:.
Human    19 EPELAQLRRKVEKLE----RELRSCKRQVREIEKLLHHTERLYQNAESNNQELRTQVEELSKILQ 79

  Fly    67 R---EEKVSCD-----------------------------KASQATESELQECQYSMENDED--- 96
            |   |:....|                             |.::.::.:.|..:.|:.|.:|   
Human    80 RGRNEDNKKSDVEVQTENHAPWSISDYFYQTYYNDVSLPNKVTELSDQQDQAIETSILNSKDHLQ 144

  Fly    97 ------------------------TNKKDQPNDLSATD----AFSFVDEMRQAAKHAENLNNFVY 133
                                    :|.::..:.|:..|    ..|..:.:|.||:.|.:...|.|
Human   145 VENDAYPGTDRTENVKYRQVDHFASNSQEPASALATEDTSLEGSSLAESLRAAAEAAVSQTGFSY 209

  Fly   134 EHTSGMYYDPKTGYYYNAEYGLYYDGNNGCYYSYDHAKDSYEFHSQAQVQA-NDAAKPESEDEDL 197
            :..:|:|:|..||:||::|..||||.:.|.||..|.....|:|||:..:|. ..::..:|:|:.|
Human   210 DENTGLYFDHSTGFYYDSENQLYYDPSTGIYYYCDVESGRYQFHSRVDLQPYPTSSTKQSKDKKL 274

  Fly   198 EVQFDELGGVITDHETLKKIKAEKQKA-------KDQAEKSKRKAKKKKSKKHSKKRSKK----- 250
            :.:..:.....|:.|  |.:.:|.|||       .::.|......||.|...|.|....|     
Human   275 KKKRKDPDSSATNEE--KDLNSEDQKAFSVEHTSCNEEENFANMKKKAKIGIHHKNSPPKVTVPT 337

  Fly   251 ------ERRHKSKKRHRHSDDER----SNDAEEGEL--SQSSDSSSDSSNEDSSSNTEDSSVPVF 303
                  ...|::........||:    .::.||||:  ||:.||..::...:.:...|||     
Human   338 SGNTIESPLHENISNSTSFKDEKIMETDSEPEEGEITDSQTEDSYDEAITSEGNVTAEDS----- 397

  Fly   304 KAAGRFQDIAKKYPPSLRIIVQETNVESLKVGSLHLIT-YKGGSLGREG--AHDVIIPDVNVSKC 365
                ..:|..|.:||.:|:||..:.|  |::|||.:|| ....::|||.  .|.:.||:|.|||.
Human   398 ----EDEDEDKIWPPCIRVIVIRSPV--LQIGSLFIITAVNPATIGREKDMEHTLRIPEVGVSKF 456

  Fly   366 HLKFKYENKLGIYQCLDLGSRNGTILNGSPM-----SSDAMDLVHGSVITLGQTRLLCHVHEGNS 425
            |.:..:::.|..|..:|.||:||||:||..:     ..|...|.||..:.:|:|.|..|:|.|:.
Human   457 HAEIYFDHDLQSYVLVDQGSQNGTIVNGKQILQPKTKCDPYVLEHGDEVKIGETVLSFHIHPGSD 521

  Fly   426 TCGLCEPG------LLIENSPPVVAAVASSTASVLSHKEQLKKLQRKYGLENEKFVDTSGNGQSN 484
            ||..||||      .|.:.....|....|.....|..:::|||::.||||:|.::.|........
Human   522 TCDGCEPGQVRAHLRLDKKDESFVGPTLSKEEKELERRKELKKIRVKYGLQNTEYEDEKTLKNPK 586

  Fly   485 YNDRAATRRVQVGSSTDKEKTEV-ACVNTEIGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPI 548
            |.|||..||.||||....::.:. |.|::||..||||.|||.|:||:|||.|||.  ..|:..||
Human   587 YKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGRKMLEKMGWKKGEGLGKD--GGGMKTPI 649

  Fly   549 NVVANEGTSGLGNSDPVLSSSRTIDKRKLANLKITQARYQRASDMF----GQSDD 599
            .:......:|||...|  ||...:...:..|.|......:|.::.|    .|.||
Human   650 QLQLRRTHAGLGTGKP--SSFEDVHLLQNKNKKNWDKARERFTENFPETKPQKDD 702

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 21/53 (40%)
OCRE repeat 1 129..136 CDD:293883 2/7 (29%)
OCRE repeat 2 137..144 CDD:293883 3/7 (43%)
OCRE repeat 3 145..152 CDD:293883 4/7 (57%)
OCRE repeat 4 153..159 CDD:293883 4/6 (67%)
OCRE repeat 5 162..169 CDD:293883 4/7 (57%)
FHA 346..411 CDD:278899 26/72 (36%)
G-patch 516..560 CDD:279867 21/44 (48%)
AGGF1NP_060516.2 OCRE_VG5Q 200..253 CDD:293883 21/53 (40%)
OCRE repeat 1 205..212 CDD:293883 2/7 (29%)
OCRE repeat 2 213..220 CDD:293883 3/7 (43%)
OCRE repeat 3 221..228 CDD:293883 4/7 (57%)
OCRE repeat 4 229..235 CDD:293883 4/6 (67%)
OCRE repeat 5 238..245 CDD:293883 4/7 (57%)
FHA 410..516 CDD:238017 40/108 (37%)
FHA <422..512 CDD:224630 33/90 (37%)
G-patch 620..661 CDD:295392 21/43 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332298181
eggNOG 1 0.900 E1_KOG0154
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3417
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D334272at33208
OrthoFinder 1 1.000 FOG0005676
OrthoInspector 1 1.000 T1073010
orthoMCL 1 0.900 OOG5_133089
Panther 1 1.100 LDO PTHR23106
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4438
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.