DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and GPATCH2

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_011507991.1 Gene:GPATCH2 HGNCID:25499 Length:551 Species:Homo sapiens

Alignment Length:563 Identity:114/564 (20%)
Similarity:189/564 (34%) Gaps:176/564 (31%)


  Fly    77 SQATESELQECQYSMENDEDTNKKDQPNDLSATDAFSFVDEMRQAAKH-AENLNNFVYEHTSGMY 140
            |:.::|.|:|.......:.:.||||.    |.:|     |:|..|.:. :.||||.|        
Human    89 SEGSDSSLEEPSKDYRENHNNNKKDH----SDSD-----DQMLVAKRRPSSNLNNNV-------- 136

  Fly   141 YDPKTGYYYNAEYGLYYDGNNGC-------YYSYDHAKDSYEFHSQAQVQANDAAKPESEDEDLE 198
             ..|...::.:::.:...||...       ..:.|..:|.  .:.:...|..:..:.:..|.|..
Human   137 -RGKRPLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDI--SNKRTMTQPPEGCRDQDMDSDRA 198

  Fly   199 VQFDELGGVITDHETLKKIKAEKQKAKDQAEKSKRKAKKKKSKKHSKKRSKKERRHKSKKRHRHS 263
            .|:.|.        |..|:|..|.|...|..|.:.:....:|          |..:::.|.....
Human   199 YQYQEF--------TKNKVKKRKLKIIRQGPKIQDEGVVLES----------EETNQTNKDKMEC 245

  Fly   264 DDERSNDAEEGELSQSSDSSSDSSNE------DSSSNTEDSSVPVF--KAAGRFQDIA------- 313
            ::::.:|    ||...|||||.||.:      |.....:|.....|  |.:|....|.       
Human   246 EEQKVSD----ELMSESDSSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKESGGACGITGVVPWWE 306

  Fly   314 KKYPPSLRIIVQETNVESLKVGSLHLITYKGGSLGREGAHDVIIPDVNVSKCHLKFKYENKLGIY 378
            |:.|..|...|.:...||:..||..|:::.    .|.|.      ...:|:.|            
Human   307 KEDPTELDKNVPDPVFESILTGSFPLMSHP----SRRGF------QARLSRLH------------ 349

  Fly   379 QCLDLGSRNGTILNGSPMSSDAMDLVHGSVITLGQTRLL-----CHVHEGNSTCGLCEPGLLIEN 438
               .:.|:|.....|:|.|   |..:.|.|   |..|::     .|.|:     ....||...|:
Human   350 ---GMSSKNIKKSGGTPTS---MVPIPGPV---GNKRMVHFSPDSHHHD-----HWFSPGARTEH 400

  Fly   439 SPPVVAAVASSTASVLSHKEQLKKLQRKYGLENEKFVDTSGNGQSNYNDRAATRR--VQVGS--- 498
            .                 :.||.:..|           .....:.|.:.|.|:|:  :.:||   
Human   401 D-----------------QHQLLRDNR-----------AERGHKKNCSVRTASRQTSMHLGSLCT 437

  Fly   499 ---------------------STDKEKTEVACVNTEIG--------------SSNKGFKMLSKLG 528
                                 |...::|.|..:..:|.              .:|.|.:||..:|
Human   438 GDIKRRRKAAPLPGPTTAGTCSHILDETHVISLAIQIFHKAGFVGENAQPILENNIGNRMLQNMG 502

  Fly   529 WQKGEKLGKTNASAGLLEPINVVANEGTSGLGNSDPVLSSSRT 571
            |..|..||:.  ..|:.|||..:......|||...|..:|:.|
Human   503 WTPGSGLGRD--GKGISEPIQAMQRPKGLGLGFPLPKSTSATT 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 10/61 (16%)
OCRE repeat 1 129..136 CDD:293883 3/7 (43%)
OCRE repeat 2 137..144 CDD:293883 0/7 (0%)
OCRE repeat 3 145..152 CDD:293883 0/7 (0%)
OCRE repeat 4 153..159 CDD:293883 0/6 (0%)
OCRE repeat 5 162..169 CDD:293883 1/14 (7%)
FHA 346..411 CDD:278899 12/65 (18%)
G-patch 516..560 CDD:279867 15/44 (34%)
GPATCH2XP_011507991.1 G-patch 491..534 CDD:279867 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4438
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.