DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and rbm5

DIOPT Version :8

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_012820244.1 Gene:rbm5 / 550032 XenbaseID:XB-GENE-494987 Length:838 Species:Xenopus tropicalis

Alignment Length:717 Identity:145/718 (20%)
Similarity:232/718 (32%) Gaps:266/718 (37%)


  Fly     8 EDLADTVAKYDSIELKSIQDLE-----------------TCEQQQLLQYVEKLHGIIRKYDTKLA 55
            :.:...:|.|.|:.:.:|:.::                 |.|..||||.::.||..: |.|.|..
 Frog   256 DSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQTLHPPL-KIDGKTV 319

  Fly    56 ------SYKQKLL----HYVSREEKVSCDKASQATESELQECQYSMENDE--------------- 95
                  |.::.|:    |.|| ...|:....:.|..|..|:.|.|.|..|               
 Frog   320 GVDFAKSARKDLVLPDGHRVS-AFSVASTAIAAAQWSSTQQAQQSGEGGEYAYLQPGQEGYANYG 383

  Fly    96 ------------DTNKKDQ------------PNDLSA-------------------------TDA 111
                        .|...:|            |...||                         |..
 Frog   384 QCSQDYQPFYQAQTGAAEQSTAPQAEGSAPVPATTSAVVCQSPQMYQQPGSPTQSGTSTAANTTP 448

  Fly   112 FSFVDEMRQAA---------KHA-ENLNNFVYEHTSGMYYDPKTGYYYNAEYGLYYDGNNGCYYS 166
            .|......:||         |:: .:.:.:.|:.:||.||||:||.||:.....||:.....|..
 Frog   449 ASTTSTTEEAAPPNAVIPGVKYSVPDTSTYQYDESSGYYYDPQTGLYYDPNSQYYYNSLTQQYLY 513

  Fly   167 YDHAKDSY----EFHSQAQVQANDAAKPESEDEDLEVQFDELGGVITDHETLKKIKAEKQKAKDQ 227
            :|..|.:|    :...|:..|.|.|....|::                    .|.|.||.|:|..
 Frog   514 WDGEKQTYLPAADGAGQSGAQPNGANAGSSKE--------------------GKEKKEKPKSKTA 558

  Fly   228 AEKSKRKAKKKKSKKHSKKRSKKERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSSNEDSS 292
            .:.:|...:..||....|:..|...:..|.:     |:||...|                     
 Frog   559 QQIAKDMERWAKSLNKQKENFKNSFQPLSAR-----DEERKESA--------------------- 597

  Fly   293 SNTEDSSVPVF-KAAGRFQDIAKKYPPSLRIIVQETNVESLKVGSLHLITYKGGSLGREGAHDVI 356
              ..|:...:| |..|..  :.:::.|.:.::|.....|  |..:..|:....|....|...:.:
 Frog   598 --AADAGFALFEKKQGAL--LERQFMPDMMMMVNTEEEE--KPPNKALVAAYSGDSDNEEESERL 656

  Fly   357 IPDVNVSK-----------CHLKFKYENKLGIYQCL-DLGSRNGTILNGSPMSSDAMDLVHGSVI 409
            :..|:..|           |..:|..::.|..:|.| ||..:|..:...|.||            
 Frog   657 LGAVDEEKLLDWKKLACLLCRRQFPNKDALTRHQQLSDLHKQNLEVYRRSKMS------------ 709

  Fly   410 TLGQTRLLCHVHEGNSTCGLCEPGLLIENSPPVVAAVASSTASVLSHKEQLKKLQRKYGLENEKF 474
                                                           :::|:.|:.|   |.|  
 Frog   710 -----------------------------------------------EQELEALELK---ERE-- 722

  Fly   475 VDTSGNGQSNYNDRAATRRVQVG----SSTDKEKTEVACVNTE------IGSSNKGFKMLSKLGW 529
                    :.|.||||.||.:.|    ....:::.:...||.|      |.:||.|.|||..:||
 Frog   723 --------AKYRDRAAERREKYGIPEPPEPKRKRFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGW 779

  Fly   530 QKGEKLGKTNASAGLLEPINVVANEGTSGLGNSDPVLSSS---RTIDKRKLANLKITQARYQRAS 591
            ::|..||:  .|.|:..||........:|||    ...||   .|.|..|.|   :.:|.:.|.|
 Frog   780 KEGSGLGR--KSQGITAPIQAQVRMRGAGLG----AKGSSYGVNTSDSYKDA---VRKAMFARFS 835

  Fly   592 DM 593
            :|
 Frog   836 EM 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 17/58 (29%)
OCRE repeat 1 129..136 CDD:293883 1/7 (14%)
OCRE repeat 2 137..144 CDD:293883 6/7 (86%)
OCRE repeat 3 145..152 CDD:293883 4/7 (57%)
OCRE repeat 4 153..159 CDD:293883 2/6 (33%)
OCRE repeat 5 162..169 CDD:293883 2/7 (29%)
FHA 346..411 CDD:278899 14/77 (18%)
G-patch 516..560 CDD:279867 17/44 (39%)
rbm5XP_012820244.1 RRM <97..>186 CDD:223796
RRM1_RBM5 98..184 CDD:241196
zf-RanBP 186..213 CDD:279035
RanBP2-type Zn finger 190..209 CDD:275375
RRM2_RBM5 240..325 CDD:241199 15/70 (21%)
OCRE_RBM5 471..526 CDD:293887 17/55 (31%)
OCRE repeat 1 476..483 CDD:293887 1/7 (14%)
OCRE repeat 2 484..491 CDD:293887 6/7 (86%)
OCRE repeat 3 492..499 CDD:293887 4/7 (57%)
OCRE repeat 4 500..507 CDD:293887 2/7 (29%)
OCRE repeat 5 509..516 CDD:293887 2/7 (29%)
G-patch 767..810 CDD:279867 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.