DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and CG8152

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_611028.1 Gene:CG8152 / 36696 FlyBaseID:FBgn0034008 Length:336 Species:Drosophila melanogaster


Alignment Length:244 Identity:52/244 - (21%)
Similarity:89/244 - (36%) Gaps:67/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 SPMSSDAMDLVHGSVITLGQTRLLCHVHEG--NSTCGLCEPGLLIENSPPVVAAVASSTASVLS- 455
            |.|.:...||  .|..:.|.|.|:....||  .:...|.:.|:.:|.|..     :.:||..|: 
  Fly   108 SQMKASEEDL--NSRDSFGWTALMMAACEGATEAVSWLVQRGVQVETSDK-----SGNTALKLAQ 165

  Fly   456 ---HKEQLKKLQRKYGLENEKFVDTSGNGQSNYNDRAATRRVQVGSSTDKEKT-----EVACVNT 512
               |.:.:..|:....||.....|.|.:|.:.:......|        |.::|     :.:.|:.
  Fly   166 RKGHLDVVHLLESLPILEETSEEDESVDGNNPFYCEICKR--------DYKETPWPIHQTSTVHQ 222

  Fly   513 --------------EIGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPINVVANEGTSGLG--- 560
                          .|.:.|:|.:::.|.||.:...||.  :.:|.|.|:..|..:..:|||   
  Fly   223 FNLKALPAHKLHKFNISAKNRGLQLMVKQGWDQEHGLGP--SQSGRLYPVKTVLRKQRTGLGIEQ 285

  Fly   561 -----------------NSDPVLSSSRT---IDKRKLANLKITQARYQR 589
                             ..||:....||   :.:.|:...|  :.||.|
  Fly   286 QSARVSHFGAFDLNAVRRRDPIYQPRRTRSDMQREKVREWK--RERYLR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883
OCRE repeat 1 129..136 CDD:293883
OCRE repeat 2 137..144 CDD:293883
OCRE repeat 3 145..152 CDD:293883
OCRE repeat 4 153..159 CDD:293883
OCRE repeat 5 162..169 CDD:293883
FHA 346..411 CDD:278899 5/16 (31%)
G-patch 516..560 CDD:279867 12/43 (28%)
CG8152NP_611028.1 Ank_4 95..144 CDD:290365 10/37 (27%)
ANK 102..>176 CDD:238125 18/74 (24%)
ANK repeat 123..154 CDD:293786 8/30 (27%)
Ank_4 124..176 CDD:290365 13/56 (23%)
G-patch 241..284 CDD:279867 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.