DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and Y55D9A.2

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_502415.1 Gene:Y55D9A.2 WormBaseID:WBGene00013224 Length:511 Species:Caenorhabditis elegans

Alignment Length:522 Identity:125/523 (24%)
Similarity:213/523 (41%) Gaps:87/523 (17%)


  Fly   113 SFVDEMRQAAKHA------------ENLNNFVYEHTSGMYYDPKTGYYYNAE----YGLYYDGNN 161
            |..:.:|:||...            .|...: :.|..||:|:|.|..:|..|    |.|..:|:.
 Worm     3 SMEEMLREAANEVLQSRIPPGYVLYPNYEQY-WSHEHGMFYNPDTEQFYRPEDKTVYQLNAEGSE 66

  Fly   162 GCYYSYDHAKDSYEFHSQAQVQAND---AAKPESEDEDLEVQFDELGGVITDHETLKKIKAEKQK 223
              |...:..|.:|......:.:|.|   :|:.:..|:: ||...|:...:.|    |.||.|:.:
 Worm    67 --YVLVERRKPTYWASRSYRKRAIDLLGSAEFKKFDQN-EVNICEIAFGMVD----KVIKGEEME 124

  Fly   224 AKDQAEKSKRKAKKKKSKKHSKKRSKKERRHKSKKRHRHSDDERSNDAEEGELSQS-----SDSS 283
            .:.:..:|....|....:....|..|..||.|:..|...::.:.|:...|..|...     .|:.
 Worm   125 KEKEYLRSIANNKVALMQHRINKVFKGNRRRKNPHRQYVANVDESSGHVEYTLQVDDYFDWEDAY 189

  Fly   284 SDSSNEDSSSNTEDSSVPVFKAAGRFQDIAKKYPPSLRIIVQETNVESLKVGSLHLITYKGGSLG 348
            .|:|:::.|.  :|....:....|..|      ||.:|:      :::|:  .||:||..||.||
 Worm   190 EDNSDDEFSE--KDEQAVLMHQEGFDQ------PPCMRV------MDALR--RLHIITISGGYLG 238

  Fly   349 REGAHDVIIPDVNVSKCHLKFKYENKLGIYQCLDLGSRNGTILNGSPM-SSDAMDLVHGSVITLG 412
            .:...::::.:..:.:...:..|..:...|....|.......:||:.: :|..:||..|..|.|.
 Worm   239 SDRDCEIVVSNQLLPERCAEIVYSEEAQCYSIEKLEDACILQVNGNNVKTSSPVDLCQGDSILLS 303

  Fly   413 QTRLLCHVHEGNSTCGLCEPGLL--IENSPPVVAAVASSTASVLSHKEQLKKLQRKYGLE----- 470
            ..|...|||.|::||..|||||.  .::..||....|.:....::.::.||::.:.||:.     
 Worm   304 GERFDVHVHNGSNTCPGCEPGLQQGDDDIAPVTTVPAKNIRGEVARRKNLKQMMKSYGIRPDDVL 368

  Fly   471 NEKFVDTSGNGQSNYNDRAATRRVQVGSSTD-------KEKTE---------------VACVNTE 513
            :|........|.|..|   ..|....|||:|       |...|               .|.....
 Worm   369 SEPIRKRPATGPSEMN---IHRSEAPGSSSDMYGSCAAKPMPEGQRKFDLPSTSAAVAAAAAPKP 430

  Fly   514 IGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPINVVANEGTSGLGNSD---PVLS-SSRTIDK 574
            :.|.|.|||:|..:||.:|:.|||  ...|.:||:.........|||.::   |..| ..:.::|
 Worm   431 LDSGNVGFKLLKSMGWSEGQGLGK--EKQGHVEPVATEVKNNRKGLGANEKEPPTKSYKDQVLEK 493

  Fly   575 RK 576
            .|
 Worm   494 TK 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 15/69 (22%)
OCRE repeat 1 129..136 CDD:293883 1/7 (14%)
OCRE repeat 2 137..144 CDD:293883 4/7 (57%)
OCRE repeat 3 145..152 CDD:293883 2/7 (29%)
OCRE repeat 4 153..159 CDD:293883 2/6 (33%)
OCRE repeat 5 162..169 CDD:293883 1/7 (14%)
FHA 346..411 CDD:278899 12/66 (18%)
G-patch 516..560 CDD:279867 17/44 (39%)
Y55D9A.2NP_502415.1 OCRE 17..70 CDD:293880 13/56 (23%)
OCRE repeat 1 22..29 CDD:293880 0/7 (0%)
OCRE repeat 2 30..37 CDD:293880 1/8 (13%)
OCRE repeat 3 38..45 CDD:293880 4/7 (57%)
OCRE repeat 4 46..52 CDD:293880 2/6 (33%)
OCRE repeat 5 54..61 CDD:293880 2/7 (29%)
G-patch 433..477 CDD:279867 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332286572
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I3496
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D334272at33208
OrthoFinder 1 1.000 FOG0005676
OrthoInspector 1 1.000 T473975
orthoMCL 1 0.900 OOG5_133089
Panther 1 1.100 LDO PTHR23106
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4438
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.