DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and RBM5

DIOPT Version :8

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_005769.1 Gene:RBM5 / 10181 HGNCID:9902 Length:815 Species:Homo sapiens

Alignment Length:691 Identity:136/692 (20%)
Similarity:214/692 (31%) Gaps:272/692 (39%)


  Fly    20 IELKSIQDLETCEQQQLLQYVEKLHGIIRKYDTK-----LASYKQKLLHYVSREEKVSC-DKASQ 78
            ::|.|..|     ..||||.::.||..: |.|.|     .|...:|.| .:|...:||. ..||.
Human   279 VQLSSAMD-----ASQLLQILQSLHPPL-KIDGKTIGVDFAKSARKDL-VLSDGNRVSAFSVAST 336

  Fly    79 A--------TESE-------------------LQECQYS-------------MENDEDT------ 97
            |        |:|:                   .|..|||             :|:|..:      
Human   337 AIAAAQWSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAV 401

  Fly    98 ---------------NKKDQPNDLSATDAFSFVDEMRQA-----------AKHA-ENLNNFVYEH 135
                           |:...|......:|........||           .|:| .:.:.:.|:.
Human   402 TTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDE 466

  Fly   136 TSGMYYDPKTGYYYNAEYGLYYDGNNGCYYSYDHAKDSYEFHSQAQVQANDAAKPESEDEDLEVQ 200
            :||.||||.||.||:.....||:.....|..:|..|::|...:::.........|..|.::.:.:
Human   467 SSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAESSSHQQSGLPPAKEGKEKKEK 531

  Fly   201 FDELGGVITDHETLKKIKAEKQKAKDQAEKSKRKAKKKKSKKHS--------------------- 244
                          .|.|..:|.|||....:|...|:|::.|:|                     
Human   532 --------------PKSKTAQQIAKDMERWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAG 582

  Fly   245 -----KKRSKKERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSSNEDSSSNTEDSSVPVFK 304
                 ||.:..||:....:..|:.|:|  |..:.|.::.   .|.||.||               
Human   583 FALFEKKGALAERQQLIPELVRNGDEE--NPLKRGLVAA---YSGDSDNE--------------- 627

  Fly   305 AAGRFQDIAKKYPPSLRIIVQETNVESLKVGSLHLITYKGGSLGREGAHDVIIPDVNVSKCHLKF 369
                                 |..||.|:.....|..:|               .:....|..:|
Human   628 ---------------------EELVERLESEEEKLADWK---------------KMACLLCRRQF 656

  Fly   370 KYENKLGIYQCL-DLGSRNGTILNGSPMSSDAMDLVHGSVITLGQTRLLCHVHEGNSTCGLCEPG 433
            ..::.|..:|.| ||..:|..|...|.:|...::.:                             
Human   657 PNKDALVRHQQLSDLHKQNMDIYRRSRLSEQELEAL----------------------------- 692

  Fly   434 LLIENSPPVVAAVASSTASVLSHKEQLKKLQRKYGLENEKFVDTSGNGQSNYNDRAATRRVQVG- 497
                                     :|::.:.|                  |.||||.||.:.| 
Human   693 -------------------------ELREREMK------------------YRDRAAERREKYGI 714

  Fly   498 ----SSTDKEKTEVACVNTE------IGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPINVVA 552
                ....|::.:...||.|      |..||.|.|||..:||::|..||:  ...|:..||....
Human   715 PEPPEPKRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGR--KCQGITAPIEAQV 777

  Fly   553 NEGTSGLGNSDPVLSSSRTIDKRKLANLKITQARYQRASDM 593
            ....:|||........|.. |..|.|   :.:|.:.|.::|
Human   778 RLKGAGLGAKGSAYGLSGA-DSYKDA---VRKAMFARFTEM 814

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 18/54 (33%)
OCRE repeat 1 129..136 CDD:293883 1/7 (14%)
OCRE repeat 2 137..144 CDD:293883 6/7 (86%)
OCRE repeat 3 145..152 CDD:293883 4/7 (57%)
OCRE repeat 4 153..159 CDD:293883 2/6 (33%)
OCRE repeat 5 162..169 CDD:293883 2/7 (29%)
FHA 346..411 CDD:278899 11/66 (17%)
G-patch 516..560 CDD:279867 16/44 (36%)
RBM5NP_005769.1 RRM 40..>181 CDD:223796
RRM1_RBM5 93..179 CDD:241196
zf-RanBP 181..210 CDD:279035
RanBP2-type Zn finger 185..204 CDD:275375
RRM2_RBM5 229..314 CDD:241199 13/41 (32%)
Required for interaction with U2AF2. {ECO:0000269|PubMed:18851835} 321..809 119/636 (19%)
Sufficient for interaction with ACIN1, PRPF8, SFRS3, SNRPB, SNRPN, SNRNP70 and SNRNP200. {ECO:0000269|PubMed:18851835} 452..535 22/97 (23%)
OCRE_RBM5 455..510 CDD:293887 18/55 (33%)
OCRE repeat 1 460..467 CDD:293887 1/7 (14%)
OCRE repeat 2 468..475 CDD:293887 6/7 (86%)
OCRE repeat 3 476..483 CDD:293887 4/7 (57%)
OCRE repeat 4 484..491 CDD:293887 2/7 (29%)
OCRE repeat 5 493..500 CDD:293887 2/7 (29%)
G-patch 743..787 CDD:279867 17/46 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.