DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8079 and aggf1

Sequence 1:NP_611023.1 Gene:CG8079 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_012822835.1 Gene:aggf1 XenbaseID:XB-GENE-6052300 Length:709 Species:Xenopus tropicalis

Alignment Length:672 Identity:201/673 (30%)
Similarity:306/673 (45%) Gaps:141/673 (21%)


  Fly    12 DTVAKYDSIELKSIQ-DLETCEQ-----QQLLQYVEKLHGIIRKYDTKLASYKQKLLHYVSRE-- 68
            ||.|.. .:.::::: :||||.|     |:.|.:.|:||......:.:|    ||.:..:|||  
 Frog    64 DTTAAL-CLRVRTLEAELETCRQELRDIQRRLSHSERLHRCTETRNLEL----QKQVEQLSRELH 123

  Fly    69 EKVSCDKASQATESELQECQY---------SMEND---------------EDTNKKD-------- 101
            |:    |.::.|..|:|...|         |..||               ||:|...        
 Frog   124 ER----KRAEQTAQEVQTDGYYGWAQSDYCSSGNDYSGFAPGMSEQVSVTEDSNSSQVVAEAVLN 184

  Fly   102 -------------QPNDLSATDA-----FSFVDEMRQAAKHAENLNNFVYEHTSGMYYDPKTGYY 148
                         |.:.:.|..|     .|..|.:|..|:.|.....|||:..:|||||..||:|
 Frog   185 KAGASSGQFVEEVQEDTVYAQQAEEEQGCSLADSLRATAEAAVTQTGFVYDENTGMYYDHSTGFY 249

  Fly   149 YNAEYGLYYDGNNGCYYSYDHAKDSYEFHSQAQVQANDAAKPESEDEDLEVQFDELGGVITDHET 213
            |::|..|||||..|.||..|.....|.:||:..:|:.....|:.                     
 Frog   250 YDSESQLYYDGTTGIYYYCDVDSGRYLYHSRVDLQSFTDTNPQP--------------------- 293

  Fly   214 LKKIKAEKQKAKDQAEKSKRKAKKKKSKK--H-------------SKKRSKKERRHKSKKRHRHS 263
             .|.|..|:|.:|.|...|.:.|:|.::|  |             .:|:::.....:|.:|...|
 Frog   294 -TKDKRSKKKRRDPASMEKEEEKEKDTEKMEHEPVSPPEREELAAERKKARMGSLVESYERESSS 357

  Fly   264 DDERSNDAEEGELSQSSDSSSDSSNEDSSSN---TEDSSVPVFKAAGRFQDIAKKYPPSLRIIVQ 325
            .||  ::.||||:: .||:...||::|.||.   |..:|.|        :|..:.:||.:|:.|.
 Frog   358 SDE--SEPEEGEIT-DSDNEKTSSDDDRSSGLSVTSHTSEP--------EDPERIWPPCIRVTVV 411

  Fly   326 ETNVESLKVGSLHLITY-KGGSLGREG--AHDVIIPDVNVSKCHLKFKYENKLGIYQCLDLGSRN 387
            .:.|  |:.|:|.:||. |..::|||.  .|.:.||::.:||.|.:..:::.|..|..:|.||:|
 Frog   412 RSPV--LQKGTLFIITADKTATIGREKDLGHTIRIPELGISKFHAEVYFDHNLQSYVLVDQGSQN 474

  Fly   388 GTILNGSPM-----SSDAMDLVHGSVITLGQTRLLCHVHEGNSTCGLCEPG------LLIENSPP 441
            ||::||:.:     .|....|.||..:..|:|.|..|||.|:.||..||||      .|.:....
 Frog   475 GTVINGNHILQPKEVSQPCVLQHGDEVKFGETVLSFHVHPGSETCDGCEPGQVRAHLRLNKKEEH 539

  Fly   442 VVAAVASSTASVLSHKEQLKKLQRKYGLENEKFVDTSGNGQSNYNDRAATRRVQVGSSTDKEKTE 506
            ....|.:.....|..|:.|||::.||||::..:.|........|.|||..||..|||....:|.|
 Frog   540 SAGPVLTKEGKELLRKQGLKKIRAKYGLQSADYEDNKVLTNPKYKDRAGRRRQVVGSDGTFQKEE 604

  Fly   507 V-ACVNTEIGSSNKGFKMLSKLGWQKGEKLGKTNASAGLLEPINVVANEGTSGLGNSDP--VLSS 568
            . |.|:.||..:|||.|||.|:||:|||.|||  :|.|:.:||.:...:..:|||..:|  :...
 Frog   605 APASVHVEINDNNKGRKMLEKMGWKKGEGLGK--SSDGIRDPIQLQLRKKKAGLGAQNPTSIEDI 667

  Fly   569 SRTIDKRKLANLKITQARYQRA 590
            ..|...:|  |.:..:.||..|
 Frog   668 QPTTQNKK--NWEKARERYAEA 687

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 24/53 (45%)
OCRE repeat 1 129..136 CDD:293883 3/7 (43%)
OCRE repeat 2 137..144 CDD:293883 5/7 (71%)
OCRE repeat 3 145..152 CDD:293883 4/7 (57%)
OCRE repeat 4 153..159 CDD:293883 4/6 (67%)
OCRE repeat 5 162..169 CDD:293883 4/7 (57%)
FHA 346..411 CDD:278899 23/72 (32%)
G-patch 516..560 CDD:279867 21/44 (48%)
aggf1XP_012822835.1 OCRE_VG5Q 225..278 CDD:293883 24/53 (45%)
OCRE repeat 1 230..237 CDD:293883 3/7 (43%)
OCRE repeat 2 238..245 CDD:293883 5/7 (71%)
OCRE repeat 3 246..253 CDD:293883 4/7 (57%)
OCRE repeat 4 254..260 CDD:293883 4/6 (67%)
OCRE repeat 5 263..270 CDD:293883 4/7 (57%)
FHA 407..512 CDD:238017 36/107 (34%)
FHA <423..508 CDD:224630 28/85 (33%)
G-patch 616..658 CDD:279867 22/44 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332299728
eggNOG 1 0.900 E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D334272at33208
OrthoFinder 1 1.000 FOG0005676
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.