DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPHR and YHR078W

DIOPT Version :8

Sequence 1:NP_611016.2 Gene:GPHR / 36682 FlyBaseID:FBgn0033995 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_011945.1 Gene:YHR078W / 856477 SGDID:S000001120 Length:552 Species:Saccharomyces cerevisiae

Alignment Length:546 Identity:121/547 (22%)
Similarity:207/547 (38%) Gaps:177/547 (32%)


  Fly    24 FFNK-----ELFKHYEIRHISVQLIFSSTFALSITMFELIIFEI----IDVLESSSRYFHWRLGL 79
            |.||     .|..|..::  |::::||..........|:|:::|    :|...:....:.|.|..
Yeast    65 FINKFYTEYSLPSHKVLQ--SLRVLFSLAMMTYTVTIEIILWQIKVAGMDKEVTFITTWVWPLTA 127

  Fly    80 TLLLFMTTAVIPIYICYSVIHSISFFSDKW--VRILTTFCWFIFIYGLWRIGDPFPLLS-ASHGI 141
            .:|.|:.....|.:|..|:::  .|::||:  .|::...|  |.:..|      ..||| .:.|.
Yeast   128 IMLSFILILFQPFFIIISLLN--KFYNDKFDIDRLIIVTC--IILSTL------IALLSYINIGP 182

  Fly   142 FTIEQGV-SRISVIGVTVMAILSGFGAVNYPY------------TSMSYFIKPVSRNDIICFERR 193
            |...:.: :|:|:.||||||.|||...|:..|            |.||   .|..||        
Yeast   183 FQYTKNILTRLSIGGVTVMASLSGLATVSSLYYNFLVIWHKFRNTPMS---DPSFRN-------- 236

  Fly   194 LALTVEMLSAKKRKIAMAIYNHNKLNPSKPRIWDMLASAVQRNTNSGEDINQLKQEVYGLEELL- 257
                              |.|.|  |.||..:|...|...::..:...:|.|..|.:..|||.: 
Yeast   237 ------------------INNSN--NNSKSLLWTTDAYIEEKIQDYEHNIEQNVQILRSLEEEVG 281

  Fly   258 -RSVF------------LELSSLKNMEERQRWSQTLKGKYFNVLGHFFSVYCVYKIFMCCINII- 308
             .|.|            |||..|:.:.::....:|.| |.|.|   .|.:||::|:.:..:..| 
Yeast   282 ENSTFKAELMEKIAWYQLELGKLEALLQQSPQVRTFK-KAFEV---GFIIYCLHKLIITFLKRIP 342

  Fly   309 -----------------FDRVGRKDPVTRGLEIAIHWCGFNI-DFAFWN---QH----------- 341
                             |......||:  .:.||      || ||:|:.   ||           
Yeast   343 YIIYHSLKYPDDYDYENFSENAASDPL--AITIA------NILDFSFFRFNYQHDLDSLTKQISL 399

  Fly   342 ---ISFLLVGCIVITSIRGLLLTL--TKF----FYRISSSKSSNIIV------------------ 379
               ||..|.....:.:....::||  .||    .:.:.:..::|::.                  
Yeast   400 FLSISLFLCCLSAVNTTISYVVTLLPIKFQILALFAMQNDDTANVLPEYTNNSSYKGKKRNYSQE 464

  Fly   380 ---------LILGQIMGMYFCSSVLLMRMNMPAEYRVIITEVLG------NLHFNFYHRWFDVIF 429
                     |::.::.|:|..::.|::|.::|.|....:.|:||      |:..:   .|||.::
Yeast   465 QKGISLIKNLVVSELTGVYVLATTLMVRSHLPFEVSQRLKELLGGKFTVPNIVID---SWFDEVY 526

  Fly   430 LVSALTTIIVL-----YLSRKPVRVD 450
            ..:.:.|.|.:     .||.|.|.|:
Yeast   527 AFACVFTFICIRIAERKLSTKKVSVE 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GPHRNP_611016.2 GPHR_N 141..208 CDD:289314 20/80 (25%)
ABA_GPCR 277..443 CDD:289215 47/246 (19%)
YHR078WNP_011945.1 GPHR_N 183..262 CDD:315250 28/110 (25%)
ABA_GPCR 308..540 CDD:315159 46/247 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2417
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I1856
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.