DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPHR and gpr89b

DIOPT Version :8

Sequence 1:NP_611016.2 Gene:GPHR / 36682 FlyBaseID:FBgn0033995 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_002940512.1 Gene:gpr89b / 100490107 XenbaseID:XB-GENE-484935 Length:455 Species:Xenopus tropicalis

Alignment Length:454 Identity:262/455 (58%)
Similarity:340/455 (75%) Gaps:17/455 (4%)


  Fly     1 MAFLGDCVIVFVSQMIFFAGGWLFFNKELFKHYEIRHISVQLIFSSTFALSITMFELIIFEIIDV 65
            |:||.|.|::.:||::||..|||||.::|||.||:|...||::||.|||.|.||||||||||:.:
 Frog     1 MSFLIDSVLMVISQLLFFGFGWLFFMRQLFKDYEVRQYVVQVVFSVTFAFSCTMFELIIFEILGL 65

  Fly    66 LESSSRYFHWRLGLTLLLFMTTAVIPIYICYSVIHSISFFSDKWVRILTTFC--WFIFIYGLWRI 128
            |.||||||||:|.|.::|.:...|:|.||.|.|:.:|.....:  |:|.: |  |..|:|..|::
 Frog    66 LNSSSRYFHWKLNLCVILLVLVFVVPFYIGYFVVSNIRLLHRQ--RLLFS-CTVWLTFMYFFWKL 127

  Fly   129 GDPFPLLSASHGIFTIEQGVSRISVIGVTVMAILSGFGAVNYPYTSMSYFIKPVSRNDIICFERR 193
            |||||:||..|||.:|||.:||:.|||||:||:||||||||.|||.||||::.|:..||:..|||
 Frog   128 GDPFPILSPKHGILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDADILALERR 192

  Fly   194 LALTVEMLSAKKRKIAMAIYN-------HNKLNPSKPRIWDMLASAVQRNTNSGEDINQLKQEVY 251
            |..|::|:.:||::||....|       |:|  ||  ..|.|:.| |..:....|:::|::|||.
 Frog   193 LLQTMDMIVSKKKRIAALRRNMFQRGEEHSK--PS--GFWGMIKS-VTSSAPVSENLSQIQQEVD 252

  Fly   252 GLEELLRSVFLELSSLKNMEERQRWSQTLKGKYFNVLGHFFSVYCVYKIFMCCINIIFDRVGRKD 316
            .||||.|.:|||.:.|...:||..:|:|.:|||||.||:|||:|||:||||..|||:|||||:.|
 Frog   253 ALEELSRQLFLETADLHATKERIEYSKTFQGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGKTD 317

  Fly   317 PVTRGLEIAIHWCGFNIDFAFWNQHISFLLVGCIVITSIRGLLLTLTKFFYRISSSKSSNIIVLI 381
            |||||:||.:::.|...|..||:|||||:|||.|::|||||||:|||||||.||||||||:|||:
 Frog   318 PVTRGIEITVNYLGIQFDVKFWSQHISFILVGIIIVTSIRGLLITLTKFFYAISSSKSSNVIVLL 382

  Fly   382 LGQIMGMYFCSSVLLMRMNMPAEYRVIITEVLGNLHFNFYHRWFDVIFLVSALTTIIVLYLSRK 445
            |.|||||||.|||||:||:||.|||.|||||||.|.|||||||||||||||||::|:.|||:.|
 Frog   383 LAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHK 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GPHRNP_611016.2 GPHR_N 141..208 CDD:289314 39/67 (58%)
ABA_GPCR 277..443 CDD:289215 122/166 (73%)
gpr89bXP_002940512.1 GPHR_N 140..207 CDD:289314 39/67 (58%)
ABA_GPCR 276..444 CDD:289215 122/168 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251319297
eggNOG 1 0.900 E1_KOG2417
Hieranoid 1 1.000
Homologene 1 1.000 H9475
Inparanoid 1 1.050 514 1.000 Inparanoid score I1186
OMA 1 1.010
OrthoDB 1 1.010 D1065554at2759
OrthoFinder 1 1.000 FOG0003826
OrthoInspector 1 1.000 T1058975
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4359
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.