DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7544 and Mettl16

DIOPT Version :8

Sequence 1:NP_001163156.1 Gene:CG7544 / 36680 FlyBaseID:FBgn0033994 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_080473.1 Gene:Mettl16 / 67493 MGIID:1914743 Length:553 Species:Mus musculus

Alignment Length:292 Identity:128/293 (44%)
Similarity:188/293 (64%) Gaps:12/293 (4%)


  Fly    13 MHPRNVLRTQ-PDYTKMAIKYKDFRQQCQLELNGKVSVNFRNEKTLRELTKMLLKEYYDLDVDFA 76
            ||.||..:.: ||:..:|.||.||:|..|:.|||:||:||::.:.:|.||..||:|.:.|.:|..
Mouse     7 MHARNRYKDKPPDFAYLASKYPDFKQHIQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIP 71

  Fly    77 PGSLVPTLALRLNYILWLEDLM-----EPLNLQNIRGIDIGCGSSCIYSLLGAKKNGWHMLALES 136
            ...|:||:.||||||.|:|||:     :...|:  ||||||.|:||||.||||..|||:.||.|.
Mouse    72 LERLIPTVPLRLNYIHWVEDLIGHQDSDKTTLR--RGIDIGTGASCIYPLLGATLNGWYFLATEV 134

  Fly   137 KPQNIEYAKENVKRNHMESLIEVYAQPDNTNIFKSYFEQDQQQLQYQFCLCNPPFFDSNLPNPLG 201
            ......|||:||::|::..||:|...|..|.:..:.  :::.::.|.||:||||||.:.| ...|
Mouse   135 DDMCFNYAKKNVEQNNLSDLIKVVKVPQKTLLMDAL--KEESEIVYDFCMCNPPFFANQL-EAKG 196

  Fly   202 GNTRNPERRPAPNNARTGSQEELTCVGGEVQFVQRIIDESLENKERVRIFTTMLGVKANVPRILD 266
            .|:|| .|||.|::..||...|:...|||::||:|||.:||:.|:|:|.::.|||.|.::..:.:
Mouse   197 VNSRN-SRRPPPSSVNTGGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKE 260

  Fly   267 YLKELQVANVSTTEFHQGHTTRWAVAWSFHSE 298
            .|:...|..|:.|||.||.|.|||:||||:.:
Mouse   261 ELRIQGVPKVTFTEFCQGRTMRWALAWSFYDD 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7544NP_001163156.1 AdoMet_MTases 45..295 CDD:302624 112/255 (44%)
Mettl16NP_080473.1 RNA-binding. {ECO:0000250|UniProtKB:Q86W50} 17..20 2/3 (67%)
Methyltransf_10 40..291 CDD:283594 113/257 (44%)
K-loop. {ECO:0000250|UniProtKB:Q86W50} 163..167 1/4 (25%)
RNA-binding. {ECO:0000250|UniProtKB:Q86W50} 199..211 6/13 (46%)
RNA-binding. {ECO:0000250|UniProtKB:Q86W50} 250..254 2/4 (50%)
RNA-binding. {ECO:0000250|UniProtKB:Q86W50} 277..283 4/6 (67%)
VCR 1. {ECO:0000250|UniProtKB:Q86W50} 289..400 1/5 (20%)
VCR 2. {ECO:0000250|UniProtKB:Q86W50} 506..553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159626050
eggNOG 1 0.900 E1_COG3129
Hieranoid 1 1.000
Homologene 1 1.000 H34653
Inparanoid 1 1.050 240 1.000 Inparanoid score I3320
Isobase 1 0.950 0 Normalized mean entropy S5435
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006072
OrthoInspector 1 1.000 T1083119
orthoMCL 1 0.900 OOG5_128986
Panther 1 1.100 LDO PTHR13393
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4658
TreeFam 1 0.960
1312.730

Return to query results.
Submit another query.