DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and LOC684466

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_008756068.1 Gene:LOC684466 RGDID:1590301 Length:179 Species:Rattus norvegicus

Alignment Length:180 Identity:60/181 (33%)
Similarity:118/181 (65%) Gaps:7/181 (4%)


  Fly    33 QNIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVGEDTFHID--QTRCIIR 95
            :::||.|.|.::..:::||.|||||||:|:::|:|:|.:|::|||:|:|::||.:.  :|:..|.
  Rat     2 KDVVAIWDVILSDGVHKIEFEHGTTSGKRVVYVDGKEEVRKEWMFQLLGKETFCVGPAKTKATIH 66

  Fly    96 VDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYRIMLKLDTLSLYVNDEL 160
            :....|:.::|:|.|:|||..::.|:.::....|:...|.     :::||:|:.:|:.::.|.::
  Rat    67 ILSGKGYVFKYTLEIEGKSFKKFVENRSKTTNTWVLHLDG-----KDFRIVLEKNTMDVWCNGKI 126

  Fly   161 RTEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVPE 210
            ......||..||:|.|.|.:.:..::|.|||.:.:||:|||:.:...:||
  Rat   127 IETAGEFVDDGTETHFSLGNHDCYIKAVSSGKRREGIIHTLIVDNREIPE 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 58/176 (33%)
LOC684466XP_008756068.1 FAIM1 3..174 CDD:284354 58/176 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166857934
eggNOG 1 0.900 E1_KOG4352
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1301275at2759
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13088
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.