DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and Faiml

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001231691.1 Gene:Faiml MGIID:3647754 Length:178 Species:Mus musculus

Alignment Length:179 Identity:66/180 (37%)
Similarity:114/180 (63%) Gaps:9/180 (5%)


  Fly    35 IVAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVGEDTFHID--QTRCIIRVD 97
            |.|.|.|.::..:::||.|||||||:|:::|:|:||:|::|||.|||::||.:.  :.:.|||:.
Mouse     3 IAAIWDVILSDGVHKIEFEHGTTSGKRVVYVDGKEVIRKEWMFPLVGKETFCVGAAKNKAIIRIL 67

  Fly    98 PAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLW-LYTDDAAADAPQEYRIMLKLDTLSLYVNDELR 161
            ...|..:.|:|.|||||..::.|:.::....| |:.||      :::||:|:..|:.::.|.::.
Mouse    68 SGKGCGFSYTLEIDGKSFRKFVENRSKTTNTWVLHLDD------KDFRIVLEKPTMDVWCNGKIV 126

  Fly   162 TEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVPE 210
            .....||..||:|.|.:.:....::|.|||.|.:||:|||:.:...:||
Mouse   127 ESVGEFVDDGTETHFSVGNHGCYIKAVSSGKKREGIIHTLIVDNREIPE 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 64/176 (36%)
FaimlNP_001231691.1 FAIM1 3..173 CDD:284354 64/176 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166857228
eggNOG 1 0.900 E1_KOG4352
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4453
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 1 1.000 T616216
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13088
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.