DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and FAIM

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_011511252.1 Gene:FAIM HGNCID:18703 Length:233 Species:Homo sapiens

Alignment Length:213 Identity:75/214 (35%)
Similarity:125/214 (58%) Gaps:12/214 (6%)


  Fly     5 SPTLRL-----ENLSTQPTMTQDHVPEDQRYNKQNIVAQWCVPINGKMYRIELEHGTTSGRRMIW 64
            |.||||     .:....|....|..|........::||.|.|.::..:::||.|||||||:|:::
Human    23 SATLRLFLPTMASGDDSPIFEDDESPPYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVY 87

  Fly    65 VNGREVLRRDWMFKLVGEDTFHID--QTRCIIRVDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYR 127
            |:|:|.:|::|||||||::||::.  :|:..|.:|...||.|||:|.|:|||..:|.||.::...
Human    88 VDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTN 152

  Fly   128 LWLYTDDAAADAPQEYRIMLKLDTLSLYVNDELRTEESVFVHGGTDTKFLLQDTEFVLQARSSGN 192
            .|:...|.     :.:||:|:.|.:.::.|.:.......||..||:|.|.:.:.:..::|.|||.
Human   153 TWVLHMDG-----ENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK 212

  Fly   193 KHDGIVHTLLANGVAVPE 210
            :.:||:|||:.:...:||
Human   213 RKEGIIHTLIVDNREIPE 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 65/176 (37%)
FAIMXP_011511252.1 FAIM1 57..228 CDD:284354 65/176 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166857184
eggNOG 1 0.900 E1_KOG4352
Hieranoid 1 1.000
Homologene 1 1.000 H8018
Inparanoid 1 1.050 141 1.000 Inparanoid score I4417
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1301275at2759
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 1 1.000 T1073330
orthoMCL 1 0.900 OOG5_134100
Panther 1 1.100 LDO PTHR13088
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3445
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.