DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and faim

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_012810305.1 Gene:faim XenbaseID:XB-GENE-975718 Length:251 Species:Xenopus tropicalis

Alignment Length:219 Identity:78/220 (35%)
Similarity:130/220 (59%) Gaps:14/220 (6%)


  Fly     2 SFLSPTLRLENLSTQPTMTQDHVPEDQ---RY----NKQNIVAQWCVPINGKMYRIELEHGTTSG 59
            |.|...:.||.:|......:..|.||:   .|    |..::||.|.|.::..:::||.|||||||
 Frog    36 SLLLLLIGLEPVSVMAAREEVTVYEDELRSHYGRLENMTDLVAMWEVALSDGIHKIEFEHGTTSG 100

  Fly    60 RRMIWVNGREVLRRDWMFKLVGEDTFHI--DQTRCIIRVDPAPGFKYEYSLYIDGKSHDQYTEDM 122
            :|:::|:|:|::|:||||||||::||.:  .||:..|.:|...||.|||:|.|:|||..:|.|:.
 Frog   101 KRVVYVDGKEIIRKDWMFKLVGKETFAVGASQTKATINIDAVSGFAYEYTLDINGKSLKKYMENR 165

  Fly   123 TRQYRLWLYTDDAAADAPQEYRIMLKLDTLSLYVNDELRTEESVFVHGGTDTKFLLQDTEFVLQA 187
            ::....|:...|.     ::.|::|:.||:.::.|.........||..||:|.|.:.:....::|
 Frog   166 SKTTNTWVLHLDG-----EDCRVVLEKDTMDVWCNGRNMETAGEFVDEGTETHFSIGNHSCCIKA 225

  Fly   188 RSSGNKHDGIVHTLLANGVAVPEA 211
            .|||.:.:||:|||:.:...:||:
 Frog   226 VSSGKRREGIIHTLIVDDREIPES 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 66/176 (38%)
faimXP_012810305.1 FAIM1 75..246 CDD:284354 66/176 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166856377
eggNOG 1 0.900 E1_KOG4352
Hieranoid 1 1.000
Homologene 1 1.000 H8018
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1301275at2759
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 1 1.000 T1059425
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.720

Return to query results.
Submit another query.