DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and faima

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001002583.1 Gene:faima ZFINID:ZDB-GENE-040718-323 Length:179 Species:Danio rerio

Alignment Length:181 Identity:74/182 (41%)
Similarity:119/182 (65%) Gaps:7/182 (4%)


  Fly    34 NIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVGEDTFHI--DQTRCIIRV 96
            ::||.|.|.::..::|||.|||||:|:|:|:::|:||:||||||||||::||::  ..|:..|.:
Zfish     4 DLVAVWEVALSDGVHRIEFEHGTTTGKRVIYIDGKEVIRRDWMFKLVGKETFNVGSTDTKATINI 68

  Fly    97 DPAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYRIMLKLDTLSLYVNDELR 161
            |...||.|||:|.|:|:|..:|.|:.::....||...|..     :.|::|:.||:.::.|.:..
Zfish    69 DAVSGFAYEYTLEINGQSLRKYMENRSKVTSTWLLNLDGI-----DCRVVLEKDTMDIWCNGQKM 128

  Fly   162 TEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVPEAK 212
            .....||..||:|.|.|.|.:..::|.|||.:.|||:||||.:|:.:.||:
Zfish   129 ETAGEFVEDGTETHFTLGDHDCCIKAVSSGKRRDGIIHTLLVDGMEISEAE 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 72/176 (41%)
faimaNP_001002583.1 FAIM1 4..175 CDD:284354 72/176 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166857322
eggNOG 1 0.900 E1_KOG4352
Hieranoid 1 1.000
Homologene 1 1.000 H8018
Inparanoid 1 1.050 151 1.000 Inparanoid score I4256
OMA 1 1.010
OrthoDB 1 1.010 D1301275at2759
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 1 1.000 T597018
orthoMCL 1 0.900 OOG5_134100
Panther 1 1.100 LDO PTHR13088
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3445
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.