DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and faimb

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_005168767.1 Gene:faimb ZFINID:ZDB-GENE-040718-91 Length:182 Species:Danio rerio

Alignment Length:182 Identity:75/183 (41%)
Similarity:117/183 (64%) Gaps:9/183 (5%)


  Fly    34 NIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNG--REVLRRDWMFKLVGEDTFHIDQT--RCII 94
            :||..|.|.::..:||||.|||:|:|:|:|::||  ||||||||||||||::||.:..|  :..|
Zfish     4 DIVGAWDVSLSDGLYRIEFEHGSTTGKRVIYINGKVREVLRRDWMFKLVGKETFPVGCTDAKATI 68

  Fly    95 RVDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYRIMLKLDTLSLYVNDE 159
            .::...||.|||:|.|:|||...:.::.::..:.|:...|.|     :|||:|:.||:.::.|.:
Zfish    69 TIEAITGFSYEYTLEINGKSLQTFLDNRSKISKTWVMKLDGA-----DYRIVLEKDTMDVWCNGQ 128

  Fly   160 LRTEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVPEA 211
            .......|...|::|.|.|.|.|..::|.:||.|.:||||:||.:|:.:.||
Zfish   129 KLETMGEFTENGSETHFALGDHECYIKATTSGRKRNGIVHSLLVDGIRIEEA 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 73/178 (41%)
faimbXP_005168767.1 FAIM1 4..177 CDD:284354 73/178 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166857551
eggNOG 1 0.900 E1_KOG4352
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4256
OMA 1 1.010
OrthoDB 1 1.010 D1301275at2759
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 1 1.000 T597018
orthoMCL 1 0.900 OOG5_134100
Panther 1 1.100 O PTHR13088
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.